KEGG   Pan troglodytes (chimpanzee): 459683Help
Entry
459683            CDS       T01005                                 

Gene name
ITGB6
Definition
(RefSeq) integrin beta-6
  KO
K06589  
integrin beta 6
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Regulation of actin cytoskeleton
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    459683 (ITGB6)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    459683 (ITGB6)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    459683 (ITGB6)
  Cellular community - eukaryotes
   04510 Focal adhesion
    459683 (ITGB6)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    459683 (ITGB6)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    459683 (ITGB6)
   05414 Dilated cardiomyopathy (DCM)
    459683 (ITGB6)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   459683 (ITGB6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
2B
AA seq 715 aa AA seqDB search
MITYKVAVPWEVQKPVKTACLLDLSVPGVLRRILLIHLELAKGGAQTLQVHVRQTEDYPV
DLYYLMDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEEI
ANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPEGGFDAIMQAAVCK
EKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDSKNEYSMSTVLEYPTIG
QLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNILQLIISAYEELRS
EVELEVLGDTEGLNLSFTAICNNSTLFQHQKKCSHMKVGDTASFNVTVNIPNCERRSRHI
IIKPVGLGDTLELLVSPECNCDCQKEVEVNSSKCHHGNGSFQCGVCACHPGHMGPRCECG
EDMLSTDSCKEAPDHPSCSGRGDCYCGQCICHLSPYGNIYGPYCQCDNFSCVRHKGLLCG
GNGDCDCGECVCRSGWTGEYCNCTTSTDSCVSEDGVLCSGRGDCVCGKCVCTNPGASGPT
CERCPTCGDPCNSKRSCIECHLSAAGQAREECVDKCKLAGATISEEEDFSKDGSVSCSLQ
GENECLITFLITTDNEGKTIIHSISEKDCPKPPNIPMIMLGVSLAILLIGVVLLCIWKLL
VSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYKHREKQKVDLSTDC
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatcacgtacaaggtggctgtgccctgggaggtgcagaaacctgtgaagactgcctgc
ttattggacctcagtgtgcctggtgtgctcaggagaattttactcatccatctggagttg
gcgaaaggtggtgcacagactctgcaggtgcatgtccgccagactgaggactacccggtg
gatttgtattacctcatggacctctccgcctccatggatgacgacctcaacacaataaag
gagctgggctcccggctttccaaagaaatgtctaaattaaccagcaactttagactgggc
ttcggatcttttgtggaaaaacctgtatccccttttgtgaaaacaacaccagaagaaatt
gccaacccttgcagtagtattccatacttctgtttacctacatttggattcaagcatatt
ttgccattgacaaatgatgctgaaagattcaatgaaattgtgaagaatcagaaaatttct
gctaatattgacacacccgaaggtggatttgatgcaattatgcaagctgctgtgtgtaag
gaaaaaattggctggcggaatgactccctccacctcctggtctttgtgagtgatgctgat
tctcattttggaatggacagcaaactagcaggcatcgtcattcctaatgacgggctctgt
cacttggacagcaagaatgaatactccatgtcaactgtcttggaatatccaacaattgga
caactcattgataaactggtacaaaacaacgtgttattgatcttcgctgtaactcaagaa
caagttcatttatatgagaattacgcaaaacttattcctggagctacagtagggctactt
cagaaggactccggaaacattctccagctgatcatctcagcttatgaagaactgcggtct
gaggtggaactggaagtattaggagacactgaaggactcaacttgtcatttacagccatc
tgtaacaacagtaccctcttccaacaccaaaagaaatgctctcacatgaaagtgggagac
acagcttccttcaacgtgactgtgaatatcccaaactgcgagagaagaagcaggcacatt
atcataaagcctgtggggctgggggacaccctggaattacttgtcagcccagaatgcaac
tgtgactgtcagaaagaagtggaagtgaacagctccaaatgtcaccacgggaacggctct
ttccagtgtggggtgtgtgcctgccaccctggccacatggggcctcgctgtgagtgtggc
gaggacatgctgagcacagattcctgcaaggaggccccagatcatccctcctgcagcgga
aggggtgactgctactgtgggcagtgtatctgccacttgtctccctatggaaacatttat
gggccttattgccagtgcgacaatttctcctgcgtgagacacaaagggctgctctgcgga
ggtaacggcgactgtgactgtggtgaatgtgtgtgcaggagcggctggactggcgagtac
tgcaactgcaccaccagcacggactcctgcgtctctgaagatggagtgctctgcagcggg
cgcggggactgtgtttgtggcaagtgtgtttgcacaaaccctggagcctcaggaccaact
tgtgaacgatgtcctacctgtggtgacccctgtaactctaaacggagctgcattgagtgc
cacctgtcagcagctggccaagcccgagaagaatgtgtggacaagtgcaaactagctggt
gcgaccatcagtgaagaagaagatttctcaaaggatggttctgtttcctgctctctgcaa
ggagaaaatgaatgtcttattacattcctaataactacagataatgaggggaaaaccatc
attcacagcatcagtgaaaaagattgtccgaagcctccaaacattcccatgatcatgtta
ggggtttccctggctattcttctcatcggggttgtcctactgtgcatctggaagctactg
gtgtcatttcatgatcgtaaagaagttgccaaatttgaagcagaacgatcaaaagccaag
tggcaaacgggaaccaatccactctacagaggctccacaagtacttttaaaaatgtaact
tataaacacagggaaaaacaaaaggtagacctttccacagattgctag

DBGET integrated database retrieval system