KEGG   Pan troglodytes (chimpanzee): 459683Help
Entry
459683            CDS       T01005                                 

Gene name
ITGB6
Definition
integrin, beta 6
Orthology
K06589  
integrin beta 6
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Regulation of actin cytoskeleton
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:ptr04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:ptr04512]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:ptr04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:ptr04510]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:ptr05410]
Human Diseases; Cardiovascular diseases; Arrhythmogenic right ventricular cardiomyopathy (ARVC) [PATH:ptr05412]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:ptr05414]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2B
AA seq 746 aa AA seqDB search
MITYKNFTHPSGVGERCDTPANLLAKGCQLNFIENPVSQVEILKNKPLSVGRQKNSSDIV
QIAPQSLILKLRPGGAQTLQVHVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLSKE
MSKLTSNFRLGFGSFVEKPVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAER
FNEIVKNQKISANIDTPEGGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKL
AGIVIPNDGLCHLDSKNEYSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYA
KLIPGATVGLLQKDSGNILQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNGTLFQH
QKKCSHMKVGDTASFNVTVNIPNCERRSRHIIIKPVGLGDTLELLVSPECNCDCQKEVEV
NSSKCHHGNGSFQCGVCACHPGHMGPRCECGEDMLSTDSCKEAPDHPSCSGRGDCYCGQC
ICHLSPYGNIYGPYCQCDNFSCVRHKGLLCGGNGDCDCGECVCRSGWTGEYCNCTTSTDS
CVSEDGVLCSGRGDCVCGKCVCTNPGASGPTCERCPTCGDPCNSKRSCIECHLSAAGQAR
EECVDKCKLAGATISEEEDFSKDGSVSCSLQGENECLITFLITTDNEGKTIIHSISEKDC
PKPPNIPMIMLGVSLAILLIGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLY
RGSTSTFKNVTYKHREKQKVDLSTDC
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgatcacgtacaagaattttactcatccatctggagttggcgaaaggtgtgatacccca
gcaaaccttttagctaaaggatgtcaattaaacttcatcgaaaaccctgtctcccaagta
gaaatacttaaaaataagcctctcagtgtaggcagacagaaaaatagttctgacattgtt
cagattgcacctcaaagcttgatccttaagttgagaccaggtggtgcacagactctgcag
gtgcatgtccgccagactgaggactacccggtggatttgtattacctcatggacctctcc
gcctccatggatgacgacctcaacacaataaaggagctgggctcccggctttccaaagaa
atgtctaaattaaccagcaactttagactgggcttcggatcttttgtggaaaaacctgta
tccccttttgtgaaaacaacaccagaagaaattgccaacccttgcagtagtattccatac
ttctgtttacctacatttggattcaagcatattttgccattgacaaatgatgctgaaaga
ttcaatgaaattgtgaagaatcagaaaatttctgctaatattgacacacccgaaggtgga
tttgatgcaattatgcaagctgctgtgtgtaaggaaaaaattggctggcggaatgactcc
ctccacctcctggtctttgtgagtgatgctgattctcattttggaatggacagcaaacta
gcaggcatcgtcattcctaatgacgggctctgtcacttggacagcaagaatgaatactcc
atgtcaactgtcttggaatatccaacaattggacaactcattgataaactggtacaaaac
aacgtgttattgatcttcgctgtaactcaagaacaagttcatttatatgagaattacgca
aaacttattcctggagctacagtagggctacttcagaaggactccggaaacattctccag
ctgatcatctcagcttatgaagaactgcggtctgaggtggaactggaagtattaggagac
actgaaggactcaacttgtcatttacagccatctgtaacaacggtaccctcttccaacac
caaaagaaatgctctcacatgaaagtgggagacacagcttccttcaacgtgactgtgaat
atcccaaactgcgagagaagaagcaggcacattatcataaagcctgtggggctgggggac
accctggaattacttgtcagcccagaatgcaactgtgactgtcagaaagaagtggaagtg
aacagctccaaatgtcaccacgggaacggctctttccagtgtggggtgtgtgcctgccac
cctggccacatggggcctcgctgtgagtgtggcgaggacatgctgagcacagattcctgc
aaggaggccccagatcatccctcctgcagcggaaggggtgactgctactgtgggcagtgt
atctgccacttgtctccctatggaaacatttatgggccttattgccagtgcgacaatttc
tcctgcgtgagacacaaagggctgctctgcggaggtaacggcgactgtgactgtggtgaa
tgtgtgtgcaggagcggctggactggcgagtactgcaactgcaccaccagcacggactcc
tgcgtctctgaagatggagtgctctgcagcgggcgcggggactgtgtttgtggcaagtgt
gtttgcacaaaccctggagcctcaggaccaacttgtgaacgatgtcctacctgtggtgac
ccctgtaactctaaacggagctgcattgagtgccacctgtcagcagctggccaagcccga
gaagaatgtgtggacaagtgcaaactagctggtgcgaccatcagtgaagaagaagatttc
tcaaaggatggttctgtttcctgctctctgcaaggagaaaatgaatgtcttattacattc
ctaataactacagataatgaggggaaaaccatcattcacagcatcagtgaaaaagattgt
ccgaagcctccaaacattcccatgatcatgttaggggtttccctggctattcttctcatc
ggggttgtcctactgtgcatctggaagctactggtgtcatttcatgatcgtaaagaagtt
gccaaatttgaagcagaacgatcaaaagccaagtggcaaacgggaaccaatccactctac
agaggctccacaagtacttttaaaaatgtaacttataaacacagggaaaaacaaaaggta
gacctttccacagattgctag

DBGET integrated database retrieval system