KEGG   Pan troglodytes (chimpanzee): 459737Help
Entry
459737            CDS       T01005                                 

Gene name
HAT1
Definition
histone acetyltransferase 1
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Alcoholism
Class
Human Diseases; Substance dependence; Alcoholism [PATH:ptr05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2B
AA seq 334 aa AA seqDB search
MFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKEVDFKPFGTLLHT
YSVLSPTGGENFTFQIYKADMTCRGFREYHERLQTFLMWFIETASFIDVDDERWHYFLVF
EKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYYT
EFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMAIEAQQKFKINK
QHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMRKCLRPEELTNQ
MNQIEISMQHEQLEESFQELVEDYRRVIERLAQE
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgttccgtgttgaatatgcatctaaagttgatgagaactttgactgtgtagaggcagat
gatgttgagggcaaaattagacaaatcattccacctggattttgcacaaacacgaatgat
ttcctttctttactggaaaaggaagttgatttcaagccattcggaaccttacttcatacc
tactcagttctcagtccaacaggaggagaaaactttacctttcagatatataaggctgac
atgacatgtagaggctttcgagaatatcatgaaaggcttcagacctttttgatgtggttt
attgaaactgctagctttattgacgtggatgatgaaagatggcactactttctagtattt
gagaagtataataaggatggagctacgctctttgcgaccgtaggctacatgacagtctat
aattactatgtgtacccagacaaaacccggccacgtgtaagtcagatgctgattttgact
ccatttcaaggtcaaggccatggtgctcaacttcttgaaacagttcatagatactacact
gaatttcctacagttcttgatattacagcggaagatccatccaaaagctatgtgaaatta
cgagactttgtgcttgtgaagctttgtcaagatttgccctgtttttcccgggaaaaatta
atgcaaggattcaatgaagatatggcgatagaggcacaacagaagttcaaaataaataag
caacacgctagaagggtttatgaaattcttcgactactggtaactgacatgagtgatgcc
gaacaatacagaagctatagactggatattaaaagaagactaattagcccatataagaaa
aagcagagagatcttgctaagatgagaaaatgtctcagaccagaagaactgacaaaccag
atgaaccaaatagaaataagcatgcaacatgaacagctggaagagagttttcaagaacta
gtggaagattaccggcgtgttattgaacgacttgctcaagagtaa

DBGET integrated database retrieval system