KEGG   Pan troglodytes (chimpanzee): 459743Help
Entry
459743            CDS       T01005                                 

Gene name
PDK1
Definition
pyruvate dehydrogenase kinase, isozyme 1
Orthology
K12077  
pyruvate dehydrogenase kinase isoform 1 [EC:2.7.11.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
HIF-1 signaling pathway
Class
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:ptr04066]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2B
AA seq 456 aa AA seqDB search
MRLARLLRGAAFAGPGPGLRAAGSSRSFSSDSGSSPASERGVPGQVDFYARFSPSPLSMK
QFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQE
LLDFKDKSAEDAKAIYERPRRTWLQVSSLCCMACKMIFTDTVIRIRNRHNDVIPTMAQGV
IEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKGKGSPSHRKHIGSIN
PNCNVVEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFEL
FKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAP
RPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERL
PVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaggctggcgcggctgcttcgcggagccgcctttgccggcccgggcccggggctgcgc
gccgccggctccagccgcagcttcagctcggactcgggctccagcccggcgtccgagcgc
ggcgttccgggccaggtggacttctacgcgcgcttctcgccgtccccgctctccatgaag
cagttcctggacttcggatcagtgaatgcttgtgaaaagacctcatttatgtttctgcgg
caagagttgcctgtcagactggcaaatataatgaaagaaataagtctccttccagataat
cttctcaggacaccatccgttcaattggtacaaagctggtatatccagagtcttcaggag
cttcttgattttaaggacaaaagtgctgaggatgctaaagctatttatgaaaggcctaga
agaacatggttgcaggtctctagtttatgctgtatggcctgcaagatgatctttacagat
actgtgatacggatcagaaaccgacacaatgatgtcattcccacaatggcccagggtgtg
attgaatacaaggagagctttggggtggatcctgtcaccagccagaatgttcagtacttt
ttggatcgattctacatgagtcgcatttcaattagaatgttactcaatcagcactcttta
ttgtttggtggaaaaggcaaaggaagtccatctcatcgaaaacacattggaagcataaat
ccaaactgcaatgtagttgaagttattaaagatggctatgaaaatgctaggcgtctgtgt
gatttgtattatattaactctcccgaactagaacttgaagaactaaatgcaaaatcacca
ggacagccaatacaagtggtttatgtaccatcccatctctatcacatggtgtttgaactt
ttcaagaatgcaatgagagccactatggaacaccatgccaacagaggtgtttacccccct
attcaagttcatgttacgctgggtaatgaggatttgactgtgaagatgagtgaccgagga
ggtggcgttcctttgaggaaaattgacagacttttcaactacatgtattcaactgcacca
agacctcgtgttgagacctcccgcgcggtgcctctggctggttttggttatggattgccc
atatcacgtctttacgcacaatacttccaaggagacctgaagctgtattccctagagggt
tacgggacagatgcagttatctacattaaggctctgtcaacagactcaatagaaagactc
ccagtgtataacaaagctgcctggaagcattacaacaccaaccacgaggctgatgactgg
tgcgtccccagcagagaacccaaagacatgacgacgttccgcagtgcctag

DBGET integrated database retrieval system