KEGG   Pan troglodytes (chimpanzee): 459743Help
Entry
459743            CDS       T01005                                 

Gene name
PDK1
Definition
(RefSeq) pyruvate dehydrogenase (acetyl-transferring) kinase isozyme 1, mitochondrial isoform X2
  KO
K12077  pyruvate dehydrogenase kinase isoform 1 [EC:2.7.11.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04066  HIF-1 signaling pathway
ptr04360  Axon guidance
ptr05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    459743 (PDK1)
 Organismal Systems
  Development
   04360 Axon guidance
    459743 (PDK1)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    459743 (PDK1)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     459743 (PDK1)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: Other
  PDHK family [OT]
   459743 (PDK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BCDHK_Adom3 HATPase_c HATPase_c_3
Motif
Other DBs
NCBI-GeneID: 459743
NCBI-ProteinID: XP_001147224
Ensembl: ENSPTRG00000012642
UniProt: A0A2I3RKX1
Position
2B
AA seq 456 aa AA seqDB search
MRLARLLRGAAFAGPGPGLRAAGSSRSFSSDSGSSPASERGVPGQVDFYARFSPSPLSMK
QFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQE
LLDFKDKSAEDAKAIYERPRRTWLQVSSLCCMACKMIFTDTVIRIRNRHNDVIPTMAQGV
IEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKGKGSPSHRKHIGSIN
PNCNVVEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFEL
FKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAP
RPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERL
PVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaggctggcgcggctgcttcgcggagccgcctttgccggcccgggcccggggctgcgc
gccgccggctccagccgcagcttcagctcggactcgggctccagcccggcgtccgagcgc
ggcgttccgggccaggtggacttctacgcgcgcttctcgccgtccccgctctccatgaag
cagttcctggacttcggatcagtgaatgcttgtgaaaagacctcatttatgtttctgcgg
caagagttgcctgtcagactggcaaatataatgaaagaaataagtctccttccagataat
cttctcaggacaccatccgttcaattggtacaaagctggtatatccagagtcttcaggag
cttcttgattttaaggacaaaagtgctgaggatgctaaagctatttatgaaaggcctaga
agaacatggttgcaggtctctagtttatgctgtatggcctgcaagatgatctttacagat
actgtgatacggatcagaaaccgacacaatgatgtcattcccacaatggcccagggtgtg
attgaatacaaggagagctttggggtggatcctgtcaccagccagaatgttcagtacttt
ttggatcgattctacatgagtcgcatttcaattagaatgttactcaatcagcactcttta
ttgtttggtggaaaaggcaaaggaagtccatctcatcgaaaacacattggaagcataaat
ccaaactgcaatgtagttgaagttattaaagatggctatgaaaatgctaggcgtctgtgt
gatttgtattatattaactctcccgaactagaacttgaagaactaaatgcaaaatcacca
ggacagccaatacaagtggtttatgtaccatcccatctctatcacatggtgtttgaactt
ttcaagaatgcaatgagagccactatggaacaccatgccaacagaggtgtttacccccct
attcaagttcatgttacgctgggtaatgaggatttgactgtgaagatgagtgaccgagga
ggtggcgttcctttgaggaaaattgacagacttttcaactacatgtattcaactgcacca
agacctcgtgttgagacctcccgcgcggtgcctctggctggttttggttatggattgccc
atatcacgtctttacgcacaatacttccaaggagacctgaagctgtattccctagagggt
tacgggacagatgcagttatctacattaaggctctgtcaacagactcaatagaaagactc
ccagtgtataacaaagctgcctggaagcattacaacaccaaccacgaggctgatgactgg
tgcgtccccagcagagaacccaaagacatgacgacgttccgcagtgcctag

DBGET integrated database retrieval system