KEGG   Pan troglodytes (chimpanzee): 459865Help
Entry
459865            CDS       T01005                                 

Gene name
CLK1
Definition
CDC-like kinase 1
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2B
AA seq 258 aa AA seqDB search
MLEWFEHHGHICIVFELLGLSTYDFIKENGFLPFRLDHIRKMAYQICKSVNFLHSNKLTH
TDLKPENILFVQSDYTEAYNPKIKRDERTLINPDIKVVDFGSATYDDEHHSTLVSTRHYR
APEVILALGWSQPCDVWSIGCILIEYYLGFTVFPTHDSKEHLAMMERILGPLPKHMIQKT
RKRKYFHHDRLDWDEHSSAGRYVSRRCKPLKEFMLSQDVEHERLFDLIQKMLEYDPAKRI
TLREALKHPFFDLLKKSI
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgttggaatggtttgagcatcatggtcacatttgcattgtttttgaactattgggactt
agtacttacgacttcattaaagaaaatggttttctaccatttcgactggatcatatcaga
aagatggcatatcagatatgcaagtctgtgaattttttgcacagtaataagttgactcac
acagacttaaagcctgaaaacatcttatttgtgcagtctgactacacagaggcgtataat
cccaaaataaaacgtgatgaacgcaccttaataaatccagatattaaagttgtagacttt
ggtagtgcaacatatgatgacgaacatcacagtacgttggtatctacaagacattataga
gcacctgaagttattttagccctagggtggtcccaaccatgtgatgtctggagcatagga
tgcattcttattgaatactatcttgggtttaccgtatttccaacacacgatagtaaggag
catttagcaatgatggaaaggattcttggacctctaccaaaacatatgatacagaaaacc
aggaaacgtaaatattttcaccatgatcgattagactgggatgaacacagttctgccggc
agatatgtttcaagacgctgtaaacctctgaaggaatttatgctttctcaagatgttgaa
catgagcgtctctttgacctcattcagaaaatgttggagtatgatccagccaaaagaatt
actctcagagaagccttaaagcatcctttctttgaccttctgaagaaaagtatatag

DBGET integrated database retrieval system