KEGG   Pan troglodytes (chimpanzee): 459865Help
Entry
459865            CDS       T01005                                 

Gene name
CLK1
Definition
CDC-like kinase 1
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     459865 (CLK1)
Protein kinases [BR:ptr01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   459865 (CLK1)
Spliceosome [BR:ptr03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    459865 (CLK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2B
AA seq 258 aa AA seqDB search
MLEWFEHHGHICIVFELLGLSTYDFIKENGFLPFRLDHIRKMAYQICKSVNFLHSNKLTH
TDLKPENILFVQSDYTEAYNPKIKRDERTLINPDIKVVDFGSATYDDEHHSTLVSTRHYR
APEVILALGWSQPCDVWSIGCILIEYYLGFTVFPTHDSKEHLAMMERILGPLPKHMIQKT
RKRKYFHHDRLDWDEHSSAGRYVSRRCKPLKEFMLSQDVEHERLFDLIQKMLEYDPAKRI
TLREALKHPFFDLLKKSI
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgttggaatggtttgagcatcatggtcacatttgcattgtttttgaactattgggactt
agtacttacgacttcattaaagaaaatggttttctaccatttcgactggatcatatcaga
aagatggcatatcagatatgcaagtctgtgaattttttgcacagtaataagttgactcac
acagacttaaagcctgaaaacatcttatttgtgcagtctgactacacagaggcgtataat
cccaaaataaaacgtgatgaacgcaccttaataaatccagatattaaagttgtagacttt
ggtagtgcaacatatgatgacgaacatcacagtacgttggtatctacaagacattataga
gcacctgaagttattttagccctagggtggtcccaaccatgtgatgtctggagcatagga
tgcattcttattgaatactatcttgggtttaccgtatttccaacacacgatagtaaggag
catttagcaatgatggaaaggattcttggacctctaccaaaacatatgatacagaaaacc
aggaaacgtaaatattttcaccatgatcgattagactgggatgaacacagttctgccggc
agatatgtttcaagacgctgtaaacctctgaaggaatttatgctttctcaagatgttgaa
catgagcgtctctttgacctcattcagaaaatgttggagtatgatccagccaaaagaatt
actctcagagaagccttaaagcatcctttctttgaccttctgaagaaaagtatatag

DBGET integrated database retrieval system