KEGG   Pan troglodytes (chimpanzee): 459901Help
Entry
459901            CDS       T01005                                 

Gene name
CREB1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 1 isoform X1
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04022  cGMP-PKG signaling pathway
ptr04024  cAMP signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04152  AMPK signaling pathway
ptr04211  Longevity regulating pathway
ptr04261  Adrenergic signaling in cardiomyocytes
ptr04380  Osteoclast differentiation
ptr04612  Antigen processing and presentation
ptr04668  TNF signaling pathway
ptr04710  Circadian rhythm
ptr04713  Circadian entrainment
ptr04714  Thermogenesis
ptr04725  Cholinergic synapse
ptr04728  Dopaminergic synapse
ptr04911  Insulin secretion
ptr04915  Estrogen signaling pathway
ptr04916  Melanogenesis
ptr04918  Thyroid hormone synthesis
ptr04922  Glucagon signaling pathway
ptr04924  Renin secretion
ptr04925  Aldosterone synthesis and secretion
ptr04926  Relaxin signaling pathway
ptr04927  Cortisol synthesis and secretion
ptr04928  Parathyroid hormone synthesis, secretion and action
ptr04931  Insulin resistance
ptr04934  Cushing's syndrome
ptr04962  Vasopressin-regulated water reabsorption
ptr05016  Huntington's disease
ptr05030  Cocaine addiction
ptr05031  Amphetamine addiction
ptr05034  Alcoholism
ptr05152  Tuberculosis
ptr05161  Hepatitis B
ptr05165  Human papillomavirus infection
ptr05166  HTLV-I infection
ptr05167  Kaposi's sarcoma-associated herpesvirus infection
ptr05203  Viral carcinogenesis
ptr05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    459901 (CREB1)
   04024 cAMP signaling pathway
    459901 (CREB1)
   04022 cGMP - PKG signaling pathway
    459901 (CREB1)
   04151 PI3K-Akt signaling pathway
    459901 (CREB1)
   04152 AMPK signaling pathway
    459901 (CREB1)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    459901 (CREB1)
  Endocrine system
   04911 Insulin secretion
    459901 (CREB1)
   04922 Glucagon signaling pathway
    459901 (CREB1)
   04915 Estrogen signaling pathway
    459901 (CREB1)
   04926 Relaxin signaling pathway
    459901 (CREB1)
   04918 Thyroid hormone synthesis
    459901 (CREB1)
   04928 Parathyroid hormone synthesis, secretion and action
    459901 (CREB1)
   04916 Melanogenesis
    459901 (CREB1)
   04924 Renin secretion
    459901 (CREB1)
   04925 Aldosterone synthesis and secretion
    459901 (CREB1)
   04927 Cortisol synthesis and secretion
    459901 (CREB1)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    459901 (CREB1)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    459901 (CREB1)
  Nervous system
   04725 Cholinergic synapse
    459901 (CREB1)
   04728 Dopaminergic synapse
    459901 (CREB1)
  Development
   04380 Osteoclast differentiation
    459901 (CREB1)
  Aging
   04211 Longevity regulating pathway - mammal
    459901 (CREB1)
  Environmental adaptation
   04710 Circadian rhythm
    459901 (CREB1)
   04713 Circadian entrainment
    459901 (CREB1)
   04714 Thermogenesis
    459901 (CREB1)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    459901 (CREB1)
   05215 Prostate cancer
    459901 (CREB1)
  Neurodegenerative diseases
   05016 Huntington's disease
    459901 (CREB1)
  Substance dependence
   05030 Cocaine addiction
    459901 (CREB1)
   05031 Amphetamine addiction
    459901 (CREB1)
   05034 Alcoholism
    459901 (CREB1)
  Endocrine and metabolic diseases
   04931 Insulin resistance
    459901 (CREB1)
   04934 Cushing's syndrome
    459901 (CREB1)
  Infectious diseases
   05152 Tuberculosis
    459901 (CREB1)
   05166 HTLV-I infection
    459901 (CREB1)
   05161 Hepatitis B
    459901 (CREB1)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    459901 (CREB1)
   05165 Human papillomavirus infection
    459901 (CREB1)
Transcription factors [BR:ptr03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    459901 (CREB1)
Mitochondrial biogenesis [BR:ptr03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    459901 (CREB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf ASD2 DUF4988
Motif
Other DBs
NCBI-GeneID: 459901
NCBI-ProteinID: XP_016805866
Ensembl: ENSPTRG00000023623
UniProt: H2R2Y2
Position
2B
AA seq 341 aa AA seqDB search
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggaatctggagccgagaaccagcagagtggagatgcagctgtaacagaagct
gaaaaccaacaaatgacagttcaagcccagccacagattgccacattagcccaggtatct
atgccagcagctcatgcaacatcatctgctcccaccgtaactctagtacagctgcccaat
gggcagacagttcaagtccatggagtcattcaggcggcccagccatcagttattcagtct
ccacaagtccaaacagttcagtcttcctgtaaggacttaaaaagacttttctccggaaca
cagatttcaactattgcagaaagtgaagattcacaggagtcagtggatagtgtaactgat
tcccaaaagcgaagggaaattctttcaaggaggccttcctacaggaaaattttgaatgac
ttatcttctgatgcaccaggagtgccaaggattgaagaagagaagtctgaagaggagact
tcagcacctgccatcaccactgtaacggtgccaactccaatttaccaaactagcagtgga
cagtatattgccattacccagggaggagcaatacagctggctaacaatggtaccgatggg
gtacagggcctgcaaacattaaccatgaccaatgcagctgccactcagccgggtactacc
attctacagtatgcacagaccactgatggacagcagatcttagtgcccagcaaccaagtt
gttgttcaagctgcctctggagacgtacaaacataccagattcgcacagcacccactagc
actattgcccctggagttgttatggcatcctccccagcacttcctacacagcctgctgaa
gaagcagcacgaaagagagaggtccgtctaatgaagaacagggaagcagctcgagagtgt
cgtagaaagaagaaagaatatgtgaaatgtttagaaaacagagtggcagtgcttgaaaat
caaaacaagacattgattgaggagctaaaagcacttaaggacctttactgccacaaatca
gattaa

DBGET integrated database retrieval system