KEGG   Pan troglodytes (chimpanzee): 459944Help
Entry
459944            CDS       T01005                                 

Gene name
USP37
Definition
ubiquitin specific peptidase 37
Orthology
K11850  
ubiquitin carboxyl-terminal hydrolase 26/29/37 [EC:3.4.19.12]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     459944 (USP37)
Peptidases [BR:ptr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   459944 (USP37)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2B
AA seq 979 aa AA seqDB search
MSPLKIHGPIRIRSMQTGITKWKEGSFEIVEKENKVSLVVHYNTGGIPRIFQLSHNIKNV
VLRPSGAKQSRLMLTLQDNSFLSIDKVPSKDAEEMRLFLDAVHQNRLPAAMKPSQGSGSF
GAILGSRTSQKETSRQLSYSDNQASAKRGSLETKDDIPFRKVLGNPGRGSIKTVAGSGIA
RMIPSLTSTSTPLRSGLLENRTEKRKRMISTGSELNEDYPKENDSSSNNKAMTDPSRKYL
TSSREKQLSLKQSEENRTSGLLPLQSSSFYGSRAGSKEHSSGGTNLDRTNVSSQTPSAKR
SLGFLPQPVPLSVKKLRCNQDYTGWNKPRVPLSSHQQQQLQGFSNLGNTCYMNAILQSLF
SLQSFANDLLKQGIPWKKIPLNALIRRFAHLLVKKDICNSETKKDLLKKVKNAISATAER
FSGYMQNDAHEFLSQCLDQLKEDMEKLNKTWKTEPVSGEENSPDISATRAYTCPVITNLE
FEVQHSIICKACGEIIPKREQFNDLSIDLPRRKKPLPPRSIQDSLDLFFRAEELEYSCEK
CGGKCALVRHKFNRLPRVLILHLKRYSFNVALSLNNKIGQQVIIPRYLTLSSHCTENTKP
PFTLGWSAHMAISRPLKASQMVNSCITSPSTPSKKFTFKSKSSLALCLDSDSEDELKRSV
ALSQRLCEMLGNEQQQEDLEKDSKLCPIEPDKSELENSGFDRMSEEELLAAVLEISKRDA
SPSLSHEDDDKPTSSPDTGFAEDDIQEMPENPDTMETEKPRTITELDPASFTEITKDCDE
NKENKTPEGSQGEVDWLQQYDMEREREEQELQQALAQSLQEQEAWEQKEDDDLKRATELS
LQEFNNSFVDALGSDEDSGNEDVFDMEYTEAEAEELKRNAETGNLPHSYRLISVVSHIGS
TSSSGHYISDVYDIKKQAWFTYNDLEVSKIQEAAVQSDRDRSGYIFFYMHKEIFDELLET
EKNSQSLSTEVGKTTRQAS
NT seq 2940 nt NT seq  +upstreamnt  +downstreamnt
atgtctcctctgaagatacatggtcctatcagaattcgaagtatgcagactgggattaca
aagtggaaagaaggatcctttgaaattgtagaaaaagagaataaagtcagcctagtagtt
cactacaatactggaggaattccaaggatatttcagctaagtcataacattaaaaatgtg
gtgcttcgacccagtggagcgaaacaaagccgcctaatgttaactctgcaagataacagc
ttcttgtctattgacaaagtaccaagtaaggatgcggaggaaatgaggttgtttctagat
gcagtccatcaaaacagacttcctgcagccatgaaaccgtctcaggggtctggtagtttt
ggagccattctgggcagcaggacctcacagaaggaaaccagcaggcagctttcttactca
gacaatcaggcttctgcaaaaagaggaagtttggaaactaaagatgatattccatttcga
aaagttcttggtaatccgggtagaggatcgattaagactgtagcaggaagtggaatagct
cggatgattccttccttgacgtctacttcaacacctcttagatcggggttgctagaaaat
cgtactgaaaagaggaaaagaatgatatcaactggctcagaattgaatgaagattaccct
aaggaaaatgattcatcatcgaacaacaaggccatgacagatccctccagaaagtattta
accagcagtagagaaaagcagctgagtttgaaacagtcagaagagaataggacatcaggg
cttttacctttacagtcatcatccttttatggtagcagagctggatccaaggaacactct
tctggtggcactaacttagacaggactaatgtttcaagccagactccctctgccaaaaga
agtttgggatttcttcctcagccagttcctctttctgttaaaaaactgagatgtaaccag
gattacactggctggaataaaccaagagtgcccctttcctctcaccaacagcagcaactg
cagggcttctccaatttgggaaatacctgctatatgaatgctattctacaatctctattt
tcactccagtcatttgcaaatgacttgcttaaacaaggtatcccatggaagaaaattcca
ctcaatgcacttatcagacgctttgcacacttgcttgttaaaaaagatatctgtaattca
gagaccaaaaaggatttactcaagaaggttaaaaatgccatttcagctacagcagagaga
ttctctggttatatgcagaatgatgctcatgaatttttaagtcagtgtttggaccagctg
aaagaagatatggaaaaattaaataaaacttggaagactgaacctgtttctggagaagaa
aattcaccagatatttcagctaccagagcatacacttgccctgttattactaatttggag
tttgaggttcagcactccatcatttgtaaagcatgtggagagattatccccaaaagagaa
cagtttaatgacctctctattgaccttcctcgtaggaaaaaaccactccctcctcgttca
attcaagattctcttgatcttttctttagggccgaagaactggagtattcttgtgagaag
tgtggtgggaagtgtgctcttgtcaggcacaaatttaacaggcttcctagggtcctcatt
ctccatttgaaacgatatagcttcaatgtggctctctcgcttaacaataagattgggcag
caagtcatcattccaagatacctgaccctgtcatctcattgcactgaaaatacaaaacca
ccttttacccttggttggagtgcacatatggcaatttctagaccattgaaagcctctcaa
atggtgaattcctgcatcaccagcccttctacaccttcaaagaaattcaccttcaaatcc
aagagctccttggctttatgccttgattcagacagtgaggatgagctaaaacgttctgtg
gccctcagccagagactttgtgaaatgttaggcaacgaacagcagcaggaagacctggaa
aaagattcaaaattatgcccaatagagcctgacaagtctgaattggaaaactcaggattt
gacagaatgagcgaagaagagcttctagcagctgtcttggagataagtaagagagatgct
tcaccatctctgagtcatgaagatgatgataagccaactagcagcccagataccggattt
gcagaagatgatattcaagaaatgccagaaaatccagacactatggaaactgagaagccc
agaacaatcacagagctggatcctgccagttttactgagataactaaagactgtgatgag
aataaagaaaacaaaactccagaaggatctcagggagaagttgattggctccagcagtat
gatatggagcgtgaaagggaagagcaagagcttcagcaggcactggctcagagccttcaa
gagcaagaggcttgggaacagaaagaagatgatgacctcaaaagagctaccgagttaagt
cttcaagagtttaacaactcctttgtggatgcattgggttctgatgaggactctggaaat
gaggatgtttttgatatggagtacacagaagctgaagctgaggaactgaaaagaaatgct
gagacaggaaatctgcctcattcgtaccggctcatcagtgttgtcagtcacattggtagc
acttcttcttcaggtcattacattagtgatgtatatgacattaagaagcaagcgtggttt
acttacaatgacctggaggtatcaaaaatccaagaggctgccgtgcagagtgatcgagat
cggagtggctacatcttcttttatatgcacaaggagatctttgatgagctgctggaaaca
gaaaagaactctcagtcacttagcacggaagtggggaagactacccgtcaggcctcgtga

DBGET integrated database retrieval system