KEGG   Pan troglodytes (chimpanzee): 459985Help
Entry
459985            CDS       T01005                                 

Gene name
IRS1
Definition
insulin receptor substrate 1
Orthology
K16172  
insulin receptor substrate 1
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
cGMP-PKG signaling pathway
FoxO signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Neurotrophin signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Type II diabetes mellitus
Non-alcoholic fatty liver disease (NAFLD)
Aldosterone-regulated sodium reabsorption
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    459985 (IRS1)
   04022 cGMP - PKG signaling pathway
    459985 (IRS1)
   04151 PI3K-Akt signaling pathway
    459985 (IRS1)
   04152 AMPK signaling pathway
    459985 (IRS1)
   04150 mTOR signaling pathway
    459985 (IRS1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    459985 (IRS1)
   04920 Adipocytokine signaling pathway
    459985 (IRS1)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    459985 (IRS1)
  Nervous system
   04722 Neurotrophin signaling pathway
    459985 (IRS1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    459985 (IRS1)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    459985 (IRS1)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    459985 (IRS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2B
AA seq 1241 aa AA seqDB search
MASPPESDGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYENEKKWRHKSSAP
KRSIPLESCFNINKRADSKNKHLVALYTRDEHFAIAADSEAEQDSWYQALLQLHNRAKGH
HDGAAALGAGGGGGSCSGSSGLGEAGEDLSYGDVPPGPAFKEVWQVILKPKGLGQTKNLI
GIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQV
DDSVVAQNMHETILEAMRAMSDEFRPRSKSQSSSNCSNPISVPLRRHHLNNPPPSQVGLT
RRSRTESITATSPASMVGGKPGSFRVRASSDGEGTMSRPASVDGSPVSPSTNRTHAHRHR
GSARLHPPLNHSRSIPMPASRCSPSATSPVSLSSSSTSGHGSTSDCLFPRRSSASVSGSP
SDGGFISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGEEELSNYICMGGKGPSTLTAPN
GHYILSRGGNGHRCTPGTGLGTSPALAGDEAASAADLDNRFRKRTHSAGTSPTINHQKTP
SQSSVASIEEYTEMMPAYPPGGGSGGRLPGHRHSAFVPTHSYPEEGLEMHPLERRGGHHR
PDSSTLHTDDGYMPMSPGVAPVPSGRKGSGDYMPMSPKSVSAPQQIINPIRRHPQRVDPN
GYMMMSPSGGCSPDIGGGPSSSSSSNAVPSGTSYGKLWTNGVGGHHSHVLPHPKPPVESS
GGKLLPCTGDYMNMSPVGDSNTSSPSDCYYGPEDPQHKPVLSYYSLPRSFKHTQRPGEPE
EGARHQHLRLSTSSGRLLYAATADDSSSSTSSDSLGGGYCGARLEPSLPHPHHQVLQPHL
PRKVDTAAQTNSRLARPTRLSLGDPKASTLPRAREQQQQQPLLHPPEPKSPGEYVNIEFG
SDQPGYLSGPVASHSSPSVRCPSQLQPAPREEETGTEEYMKMDLGPGRRAAWQESTGVEM
GRLGPAPPGAASICRPTRAVPSSRGDYMTMQMSCPRQSYVDTSPAAPVSYADMRTGIAAE
EVSLPRATMVAASSSSAVSASPTGPQGAAELAAHSSLLGGPQGPGGMSAFTRVNLSPNRN
QSAKVIRADPQGCRRRHSSETFSSTPSATRVGNTVPFGAGATVGGGGGSSSSSSEDVKRH
SSASFENVWLRPGELGGAPKEPAQLCGAAGGLENGLNYIDLDLVKDFKQCPQECTPEPQP
PPPPPPHQPLGSGESSSTRRSSEDLSAYASISFQKQPEDRQ
NT seq 3726 nt NT seq  +upstreamnt  +downstreamnt
atggcgagccctccggagagcgatggcttctcggacgtgcgcaaggtgggctacctgcgc
aaacccaagagcatgcacaaacgcttcttcgtactgcgcgcggccagcgaggctgggggc
ccggcgcgcctcgagtactacgagaacgagaagaagtggcggcacaagtcgagcgccccc
aaacgctcgatcccccttgagagctgcttcaacatcaacaagcgggctgactccaagaac
aagcacctggtggctctctacacccgggacgagcactttgccatcgcggcggacagcgag
gccgagcaagacagctggtaccaggctctcctacagctgcacaaccgtgctaagggccac
cacgacggagctgcggccctcggggcgggaggtggtgggggcagctgcagcggcagctcc
ggccttggtgaggctggggaggacttgagctacggtgacgtgcccccaggacccgcattc
aaagaggtctggcaagtgatcctgaagcccaagggcctgggtcagacaaagaacctgatt
ggtatctaccgcctttgcctgaccagcaagaccatcagcttcgtgaagctgaactcggag
gcagcggccgtggtgctgcagctgatgaacatcaggcgctgtggccactcggaaaacttc
ttcttcatcgaggtgggccgttctgccgtgacggggcccggggagttctggatgcaggtg
gatgactctgtggtggcccagaacatgcacgagaccatcctggaggccatgcgggccatg
agtgatgagttccgccctcgcagcaagagccagtcctcgtccaactgctctaaccccatc
agcgtccccctgcgccggcaccatctcaacaatcccccgcccagccaggtggggctgacc
cgccgatcgcgcactgagagcatcaccgccacctccccggccagcatggtgggcgggaag
ccaggctccttccgtgtccgcgcctccagtgacggcgaaggcaccatgtcccgcccagcc
tcggtggacggcagccctgtgagtcccagcaccaacagaacccacgcccaccggcatcgg
ggcagcgcccggctgcaccccccgctcaaccacagccgctccatccccatgccggcttcc
cgctgctcgccttcggccaccagcccggtcagtctgtcgtccagtagcaccagtggccat
ggctccacctcggattgtctcttcccacggcgatctagtgcttcggtgtctggttccccc
agcgatggcggtttcatctcctcggatgagtatggctccagtccctgcgatttccggagt
tccttccgcagtgtcactccggattccctgggccacaccccaccagcccgcggtgaggag
gagctaagcaactatatctgcatgggtggtaaggggccctccaccctgaccgcccccaac
ggtcactacattttgtctcggggtggcaatggccaccgctgcaccccaggaacaggcttg
ggcacgagtccagccttggctggggatgaagcagccagtgctgcagatctggataatcgg
ttccgaaagagaactcactcggcaggcacatcccctaccattaaccaccagaagaccccg
tcccagtcctcagtggcttccattgaggagtacacagagatgatgcctgcctacccacca
ggaggtggcagtggaggccgactgccgggacacaggcactccgccttcgtgcccacccac
tcctacccagaggagggtctggaaatgcaccccttggagcgtcggggggggcaccaccgc
ccagacagctccaccctccacacggatgatggctacatgcccatgtccccaggggtggcc
ccagtgcccagcggccgaaagggcagtggagactatatgcccatgagccccaagagcgta
tctgccccacagcagatcatcaatcccatcagacgccatccccagagagtggaccccaat
ggctacatgatgatgtcccccagcggcggctgctctcctgacattggaggtggccccagc
agcagcagcagcagcaatgccgtcccttccgggaccagctatggaaagctgtggacaaac
ggggtagggggccaccactctcatgtcttgcctcaccccaaacccccagtggagagcagc
ggtggtaagctcttaccttgcacaggtgactacatgaacatgtcaccagtgggggactcc
aacaccagcagcccctccgactgctactacggccctgaggacccccagcacaagccagtc
ctctcctactactcattgccaagatcctttaagcacacccagcgccccggggagccggag
gagggtgcccggcatcagcacctccgcctttccactagctctggtcgccttctctatgct
gcaacagcggatgattcttcctcttccaccagcagcgacagcctgggtgggggatactgc
ggggctaggctggagcccagccttccacatccccaccatcaggttctgcagccccatctg
cctcgaaaggtggacacagctgctcagaccaatagccgcctggcccggcccacgaggctg
tccctgggggatcccaaggccagcaccttacctcgggcccgagagcagcagcagcagcag
cccttgctgcaccctccagagcccaagagcccgggggaatatgtcaatattgaatttggg
agtgatcagcctggctacttgtctggcccggtggcttcccacagctcaccttctgtcagg
tgtccatcccagctccagccagctcccagagaggaagagactggcactgaggagtacatg
aagatggacctggggccgggccggagggcagcttggcaggagagcactggggtcgagatg
ggcagactgggccctgcacctcccggggctgctagcatttgcaggcctacccgggcagtg
cccagcagccggggtgactacatgaccatgcagatgagttgtccccgtcagagctacgtg
gacacctcgccagctgcccctgtaagctatgctgacatgcggacaggcattgctgcagag
gaggtgagcctgcccagggccaccatggttgctgcctcctcatcctcagcagtctctgct
tccccgactgggcctcaaggggcagcagagctggctgcccactcgtccctgctggggggc
ccacaaggacctgggggcatgagcgccttcacccgggtgaacctcagtcctaaccgcaac
cagagtgccaaagtgatccgtgcagacccacaagggtgccggcggaggcatagctccgag
actttctcctcaacacccagtgccacccgggtgggcaacacagtgccctttggagcgggg
gcaacagtagggggcggtggcggtagcagcagcagcagcagcgaggatgtgaaacgccac
agctctgcttcctttgagaatgtgtggctgaggcctggggagcttgggggagcccccaag
gagccagcccaactgtgtggggctgctgggggtttggagaatggtcttaactacatagac
ctggatttggtcaaggacttcaaacagtgccctcaggagtgcacccctgaaccgcagcct
cccccacccccaccccctcatcaacccctgggcagcggtgagagcagctccacccgccgc
tcaagtgaggatttaagcgcctatgccagcatcagtttccagaagcagccagaggaccgt
cagtag

DBGET integrated database retrieval system