KEGG   Pan troglodytes (chimpanzee): 460015Help
Entry
460015            CDS       T01005                                 

Gene name
EIF4E2
Definition
(RefSeq) eukaryotic translation initiation factor 4E type 2 isoform X2
  KO
K03259  translation initiation factor 4E
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01521  EGFR tyrosine kinase inhibitor resistance
ptr03013  RNA transport
ptr04066  HIF-1 signaling pathway
ptr04150  mTOR signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04211  Longevity regulating pathway
ptr04910  Insulin signaling pathway
Module
ptr_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    460015 (EIF4E2)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    460015 (EIF4E2)
   04151 PI3K-Akt signaling pathway
    460015 (EIF4E2)
   04150 mTOR signaling pathway
    460015 (EIF4E2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    460015 (EIF4E2)
  Aging
   04211 Longevity regulating pathway - mammal
    460015 (EIF4E2)
 Human Diseases
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    460015 (EIF4E2)
Messenger RNA biogenesis [BR:ptr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     460015 (EIF4E2)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     460015 (EIF4E2)
Translation factors [BR:ptr03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    460015 (EIF4E2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 460015
NCBI-ProteinID: XP_009442834
Ensembl: ENSPTRG00000013043
Position
2B
AA seq 240 aa AA seqDB search
MSLKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYS
RRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWE
DDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNK
TASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgaaagatgatgacagtggggaccatgatcagaatgaagaaaacagcacacag
aaagatggtgagaaggaaaaaacggaacgagacaagaatcagagcagtagcaagagaaag
gctgtcgtccctggaccggcagagcatcccctgcagtacaactacactttttggtactcc
aggagaacccccggccgtcccacgagctcacagagctatgaacagaatatcaaacagatt
ggcacctttgcctctgtggagcagttctggaggttttatagccacatggtacgtcctggg
gacctgacaggccacagtgacttccatctcttcaaagaaggaattaaacccatgtgggag
gatgatgcaaataaaaatggtggcaagtggattattcggctgcggaagggcttggcctcc
cgttgctgggagaatctcattttggccatgctgggggaacagttcatggttggggaggag
atctgtggggctgtggtgtctgtccgctttcaggaggacattatttcaatatggaataag
actgccagtgaccaagcaaccacagcccgaatccgggacacacttcggcgagtgcttaac
ctacctcccaacaccattatggaatacaaaactcacaccgacagcatcaaaatgccaggc
aggctgggcccccaaaggctcctttttcaaaacctctggaagccgcggttgaatgtgcca
tga

DBGET integrated database retrieval system