KEGG   Pan troglodytes (chimpanzee): 460015Help
Entry
460015            CDS       T01005                                 

Gene name
EIF4E2
Definition
eukaryotic translation initiation factor 4E family member 2
Orthology
K03259  
translation initiation factor 4E
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
RNA transport
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:ptr03013]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:ptr04066]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:ptr04151]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:ptr04150]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:ptr04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2B
AA seq 245 aa AA seqDB search
MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNY
TFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGI
KPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDII
SIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKP
RLNVP
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaagttcgacgctttgaaagatgatgacagtggggaccatgatcagaatgaa
gaaaacagcacacagaaagatggtgagaaggaaaaaacggaacgagacaagaatcagagc
agtagcaagagaaaggctgttgtccctggaccggcagagcatcccctgcagtacaactac
actttttggtactccaggagaacccccggccgtcccacgagctcacagagctatgaacag
aatatcaaacagattggcacctttgcctctgtggagcagttctggaggttttatagccac
atggtacgtcctggggacctgacaggccacagtgacttccatctcttcaaagaaggaatt
aaacccatgtgggaggatgatgcaaataaaaatggtggcaagtggattattcggctgcgg
aagggcttggcctcccgttgctgggagaatctcattttggccatgctgggggaacagttc
atggttggggaggagatctgtggggctgtggtgtctgtccgctttcaggaggacattatt
tcaatatggaataagactgccagtgaccaagcaaccacagcccgaatccgggacacactt
cggcgagtgcttaacctacctcccaacaccattatggaatacaaaactcacaccgacagc
atcaaaatgccaggcaggctgggcccccaaaggctcctttttcaaaacctctggaagccg
cggttgaatgtgccatga

DBGET integrated database retrieval system