KEGG   Pan troglodytes (chimpanzee): 460219Help
Entry
460219            CDS       T01005                                 

Gene name
KAT2B, PCAF
Definition
(RefSeq) lysine acetyltransferase 2B
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    460219 (KAT2B)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    460219 (KAT2B)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    460219 (KAT2B)
  Infectious diseases
   05166 HTLV-I infection
    460219 (KAT2B)
Enzymes [BR:ptr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     460219 (KAT2B)
Transcription machinery [BR:ptr03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     460219 (KAT2B)
Chromosome [BR:ptr03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    460219 (KAT2B)
   HAT complexes
    PCAF complex
     460219 (KAT2B)
    STAGA complex
     460219 (KAT2B)
    TFTC complex
     460219 (KAT2B)
    SAGA complex
     460219 (KAT2B)
    SLIK complex
     460219 (KAT2B)
    ADA-HAT complex
     460219 (KAT2B)
    HAT-A2 complex
     460219 (KAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 832 aa AA seqDB search
MSEAGGAGPGGCGAGAGAGAGPGALPPQPAALPPAPPQGSPCAAAAGGSGACGPATAVAA
AGTAEGPGGGGSARIAVKKAQLRSAPRAKKLEKLGVYSACKAEESCKCNGWKNPNPSPTP
PRADLQQIIVSLTESCRSCSHALAAHVSHLENVSEEEMNRLLGIVLDVEYLFTCVHKEED
ADTKQVYFYLFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPAKE
RQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPR
YETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPLEKRTLILTHFPKFLSMLEEEVYSQ
NSPIWDQDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPSAGSSSPACKASSG
LEANPGEKRKMTDSHVLEEAKKPRVMGDIPMELINEVMSTITDPAAMLGPETNFLSAHSA
RDEAARLEERRGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFD
PKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKH
DILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPRIPYTEFS
VIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKPSGKEKSK
EPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNR
YYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaggctggcggggccgggccgggcggctgcggggcaggagccggggcaggggcc
gggcccggggcgctgcccccgcagcctgcggcgcttccgcccgcgcccccgcagggctcc
ccctgcgccgctgccgccgggggctcgggcgcctgcggtccggcgacggcagtggctgca
gcgggcacggccgaaggaccgggaggcggtggctcggcccgaatcgccgtgaagaaagcg
caactacgctccgctccgcgggccaagaaactggagaaactcggagtgtactccgcctgc
aaggccgaggagtcttgtaaatgtaatggctggaaaaaccctaacccctcacccactccc
cccagagccgatctgcagcaaataattgtcagtctaacagaatcctgtcggagttgtagc
catgccctagctgctcatgtttcccacctggagaatgtgtcagaggaagaaatgaacaga
ctcctgggaatagtattggatgtggagtatctctttacctgtgtccacaaggaagaagat
gcagataccaaacaagtttatttctatctatttaagctcttgagaaagtctattttacaa
agaggaaaacctgtggttgaaggctctttggaaaagaaacccccatttgaaaaacctagc
attgaacagggtgtgaataactttgtacagtacaaatttagtcacctgccagcaaaagaa
aggcaaacaatagttgagttggcaaaaatgttcctaaaccgcatcaactattggcatctg
gaggcaccatctcaacgaagactgcgatctcccaatgatgatatttctggatacaaagag
aactacacaaggtggctgtgttactgcaacgtgccacagttctgtgacagtctacctcgg
tacgaaaccacacaggtgtttgggagaacattgcttcgctcggtcttcactgttatgagg
cgacaactcctggaacaagcaagacaggaaaaagataaactgcctcttgaaaaacgaact
ctaatcctcactcatttcccaaaatttctgtccatgctagaagaagaagtatatagtcaa
aactctcccatctgggatcaggattttctctcagcctcttccagaaccagccagctaggc
atccaaacagttatcaatccacctcctgtggctgggacaatttcatacaattcaacctca
tcttcccttgagcagccaagcgcagggagcagcagtcctgcctgcaaagcctcttctgga
cttgaggcaaacccaggagaaaagaggaaaatgactgattctcatgttctggaggaggcc
aagaaaccccgagttatgggggatattccgatggaattaatcaacgaggttatgtctacc
atcacggaccctgcagcaatgcttggaccagagaccaattttctgtcagcacactcggcc
agggatgaggcggcaaggttggaagagcgcaggggtgtaattgaatttcacgtggttggc
aattccctcaaccagaaaccaaacaagaagatcctgatgtggctggttggcctacagaac
gttttctcccaccagctgccccgaatgccaaaagaatacatcacacggctcgtctttgac
ccgaaacacaaaacccttgctttaattaaagatggccgtgttattggtggtatctgtttc
cgtatgttcccatctcaaggattcacagagattgtcttctgtgctgtaacctcaaatgag
caagtcaagggctatggaacacacctgatgaatcatttgaaagaatatcacataaagcat
gacatcctgaacttcctcacatatgcagatgaatatgcaattggatactttaagaaacag
ggtttctccaaagaaattaaaatacctaaaaccaaatatgttggctatatcaaggattat
gaaggagccactttaatgggatgtgagctaaatccacggatcccgtacacagaattttct
gtcatcattaaaaagcagaaggagataattaaaaagctgattgaaagaaaacaggcacaa
attcgaaaagtttaccctggactttcatgttttaaagatggagttcgacagattcctata
gaaagcattcctggaattagagagacaggctggaaaccgagtggaaaagagaaaagtaaa
gagcccagagaccctgaccagctttacagcacgctcaagagcatcctccagcaggtgaag
agccatcaaagcgcttggcccttcatggaacctgtgaagagaacagaagctccaggatat
tatgaagttataaggttccccatggatctgaaaaccatgagtgaacgcctcaagaatagg
tactacgtgtctaagaaattattcatggcagacttacagcgagtctttaccaattgcaaa
gagtacaacccccctgagagtgaatactacaaatgtgccaatatcctggagaaattcttc
ttcagtaaaattaaggaagctggattaattgacaagtga

DBGET integrated database retrieval system