KEGG   Pan troglodytes (chimpanzee): 460219Help
Entry
460219            CDS       T01005                                 

Gene name
KAT2B, PCAF
Definition
K(lysine) acetyltransferase 2B
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:ptr04330]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:ptr04919]
Human Diseases; Cancers; Viral carcinogenesis [PATH:ptr05203]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:ptr05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 927 aa AA seqDB search
MIERLPPPTGAGVRGSDGGPRRGEVASRCLGSRPLPPPSSPPSPTPKDWPRPLAGERGRA
LGEGLALTTTRAREGDPGDGGGARHSAPPAVLRGGKYEAGGAGPGGNGAGAGAGAGTGAL
PPQTAALPPAPPQGSPCAAAAGGSGACGPATAVAAAGTAEGPGGGGSARIAVKKAQLRSA
PRAKKLEKLGVYSACKAEESCKCNGWKNPNPSPTPPRADLQQIIVSLTESCRSCSHALAA
HVSHLENVSEEEMNRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKSILQRGKPV
VEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPAKERQTIVELAKMFLNRINYWHLEAPSQ
RRLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPRYETTQVFGRTLLRSVFTVMRRQLLE
QARQEKDKLPLEKRTLILTHFPKFLSMLEEEVYSQNSPIWDQDFLSASSRTSQLGIQTVI
NPPPVAGTISYNSTSSSLEQPSAGSSSPACKASSGLEANPGEKRKMTDSHVLEEAKKPRV
MGDIPMELINEVMSTITDPAAMLGPETNFLSAHSARDEAARLEERRGVIEFHVVGNSLNQ
KPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPS
QGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHDILNFLTYADEYAIGYFKKQGFSKE
IKIPKTKYVGYIKDYEGATLMGCELNPRIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVY
PGLSCFKDGVRQIPIESIPGIRETGWKPSGKEKSKEPRDPDQLYSTLKSILQQVKSHQSA
WPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPP
ESEYYKCANILEKFFFSKIKEAGLIDK
NT seq 2784 nt NT seq  +upstreamnt  +downstreamnt
atgattgagaggctgccccctcccactggtgcaggcgtgcgggggtcggatgggggaccg
cggaggggggaggtggccagcaggtgcctgggctccaggcccctacccccaccctcgtcc
ccaccctcacccacacccaaggattggcctcgccccctggcgggcgagcgcgggagggcg
ttgggggagggtctcgctctcacgactaccagagcacgagagggagaccctggcgacggc
ggcggcgccagacactcggcgcctcctgccgtgctccggggcggcaagtacgaggcaggc
ggggccggaccgggcggaaacggggcaggagccggggcaggggccgggaccggggcgctg
cccccgcaaactgcggcgcttccgcccgcgcccccgcagggctccccctgcgccgctgcc
gccgggggctcgggcgcctgcggtccggcgacggcagtggctgcagcgggcacggccgaa
ggaccgggaggcggtggctcggcccgaatcgccgtgaagaaagcgcaactacgctccgct
ccgcgggccaagaaactggagaaactcggagtgtactccgcctgcaaggccgaggagtct
tgtaaatgtaatggctggaaaaaccctaacccctcacccactccccccagagccgatctg
cagcaaataattgtcagtctaacagaatcctgtcggagttgtagccatgccctagctgct
catgtttcccacctggagaatgtgtcagaggaagaaatgaacagactcctgggaatagta
ttggatgtggagtatctctttacctgtgtccacaaggaagaagatgcagataccaaacaa
gtttatttctatctatttaagctcttgagaaagtctattttacaaagaggaaaacctgtg
gttgaaggctctttggaaaagaaacccccatttgaaaaacctagcattgaacagggtgtg
aataactttgtacagtacaaatttagtcacctgccagcaaaagaaaggcaaacaatagtt
gagttggcaaaaatgttcctaaaccgcatcaactattggcatctggaggcaccatctcaa
cgaagactgcgatctcccaatgatgatatttctggatacaaagagaactacacaaggtgg
ctgtgttactgcaacgtgccacagttctgtgacagtctacctcggtacgaaaccacacag
gtgtttgggagaacattgcttcgctcggtcttcactgttatgaggcgacaactcctggaa
caagcaagacaggaaaaagataaactgcctcttgaaaaacgaactctaatcctcactcat
ttcccaaaatttctgtccatgctagaagaagaagtatatagtcaaaactctcccatctgg
gatcaggattttctctcagcctcttccagaaccagccagctaggcatccaaacagttatc
aatccacctcctgtggctgggacaatttcatacaattcaacctcatcttcccttgagcag
ccaagcgcagggagcagcagtcctgcctgcaaagcctcttctggacttgaggcaaaccca
ggagaaaagaggaaaatgactgattctcatgttctggaggaggccaagaaaccccgagtt
atgggggatattccgatggaattaatcaacgaggttatgtctaccatcacggaccctgca
gcaatgcttggaccagagaccaattttctgtcagcacactcggccagggatgaggcggca
aggttggaagagcgcaggggtgtaattgaatttcacgtggttggcaattccctcaaccag
aaaccaaacaagaagatcctgatgtggctggttggcctacagaacgttttctcccaccag
ctgccccgaatgccaaaagaatacatcacacggctcgtctttgacccgaaacacaaaacc
cttgctttaattaaagatggccgtgttattggtggtatctgtttccgtatgttcccatct
caaggattcacagagattgtcttctgtgctgtaacctcaaatgagcaagtcaagggctat
ggaacacacctgatgaatcatttgaaagaatatcacataaagcatgacatcctgaacttc
ctcacatatgcagatgaatatgcaattggatactttaagaaacagggtttctccaaagaa
attaaaatacctaaaaccaaatatgttggctatatcaaggattatgaaggagccacttta
atgggatgtgagctaaatccacggatcccgtacacagaattttctgtcatcattaaaaag
cagaaggagataattaaaaagctgattgaaagaaaacaggcacaaattcgaaaagtttac
cctggactttcatgttttaaagatggagttcgacagattcctatagaaagcattcctgga
attagagagacaggctggaaaccgagtggaaaagagaaaagtaaagagcccagagaccct
gaccagctttacagcacgctcaagagcatcctccagcaggtgaagagccatcaaagcgct
tggcccttcatggaacctgtgaagagaacagaagctccaggatattatgaagttataagg
ttccccatggatctgaaaaccatgagtgaacgcctcaagaataggtactacgtgtctaag
aaattattcatggcagacttacagcgagtctttaccaattgcaaagagtacaacccccct
gagagtgaatactacaaatgtgccaatatcctggagaaattcttcttcagtaaaattaag
gaagctggattaattgacaagtga

DBGET integrated database retrieval system