KEGG   Pan troglodytes (chimpanzee): 460267Help
Entry
460267            CDS       T01005                                 

Gene name
PLCD1
Definition
(RefSeq) phospholipase C, delta 1
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    460267 (PLCD1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    460267 (PLCD1)
   04070 Phosphatidylinositol signaling system
    460267 (PLCD1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    460267 (PLCD1)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     460267 (PLCD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 781 aa AA seqDB search
MQCLGIRSRSRSRSRELYLQEQSLKVAALNGRRLGLQDDEDLQALLKGSQLLKVKSSSWR
RERFYKLQEDCKTIWQESRKVMRTPESQLFSIEDIQEVRMGHRTEGLEKFARDVPEDRCF
SIVFKDQRNTLDLIAPSPADAQHWVLGLHKIIHHSGSMDQRQKLQHWIHSCLRKADKNKD
NKMSFKELQNFLKELNIQVDDSYARKIFRECDHSQTDSLEDEEIEAFYKMLTQRVEIDRT
FAEAVGSGETLSVDQLVTFLQHQQREEAAGPALALSLIERYEPSETAKAQRQMTKDGFLM
YLLSADGSAFSLAHRRVYQDMGQPLSHYLVSSSHNTYLLEDQLAGPSSTEAYIRALCKGC
RCLELDCWDGPNQEPIIYHGYTFTSKILFCDVLRAIRDYAFKASPYPVILSLENHCTLEQ
QRVMARHLHAILGPMLLNRPLDGITNSLPSPEQLKGKILLKGKKLGGLLPPAGEGGPEAT
VVSDEDEAAEMEDEAVRSRVQHKPKEDKLRLAQELSDMVIYCKSVHFGGFSSPGTPGQAF
YEMASFSENRALRLLQESGNGFVRHNVGHLSRIYPAGWRTDSSNYSPVEMWNGGCQIVAL
NFQTPGPEMDVYQGRFQDNGACGYVLKPAFLRDPNGTFNPRALAQGPWWARKRLNIRVIS
GQQLPKVNKNKNSIVDPKVTVEIHGVSRDVASRQTAVITNNGFNPWWDTEFAFEVVVPDL
ALVRFLVEDYDASSXNDFIGQSTIPLNSLKQGECQEKWMHAYHTLYGLPAFTDTHKMTRR
L
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgcctggggatccggagccggagccggagccgctccagggagctctacctgcag
gagcagagccttaaggtggcggcactcaatggacggaggctgggcctacaggatgatgag
gatctacaggcgctgctgaagggcagccagctcctgaaggtgaaatccagctcatggagg
agagagcgcttctacaagttgcaggaggactgcaagaccatctggcaggagtcccgcaag
gtcatgcggaccccggagtcccagctgttctccatcgaggacattcaggaggtgcgaatg
gggcaccgcacggagggtctggagaagttcgcccgtgatgtgcccgaggaccgctgcttc
tccattgtcttcaaggaccagcgcaatacactagacctcatcgccccatcgccagctgat
gcccagcactgggtgctggggctgcacaagatcatccaccactcaggctccatggaccag
cgtcagaagctacagcactggattcactcctgcttgcgaaaagctgacaaaaacaaggac
aacaagatgagcttcaaggagctgcagaacttcctgaaggagctcaacatccaggtggac
gacagctatgcccggaagatcttcagggagtgtgaccactcccagacagactccctggag
gatgaggagattgaggccttctacaagatgctgacccagcgggtggagatcgaccgcacc
ttcgccgaggccgtgggctcaggggagactctgtcggtggatcagttagtgacgttcctg
cagcaccagcagcgggaggaggcggcagggcctgcgctggccctctccctcattgagcgc
tatgagcccagcgagactgccaaggcgcagcggcagatgaccaaggacggcttcctcatg
tacttactgtcggctgacggcagcgccttcagcctggcacaccgccgtgtctaccaggac
atgggccagccgcttagccactacctggtgtcctcttcacacaacacctacctgctggag
gaccagctagccgggcccagcagcactgaagcctacatccgggcactgtgcaaaggctgc
cgatgcctggagcttgactgctgggacgggcccaaccaggaaccaatcatctaccacggc
tatactttcacttccaagatcctcttctgcgatgtgctcagggccatccgggactatgcc
ttcaaggcgtccccctaccctgtcatcctatccctggagaaccactgcacactggagcag
cagcgcgtgatggcgcggcacctgcacgccatcctgggccccatgctgttgaaccgacca
ctggatgggatcaccaacagcctgccctcccctgagcaactgaaggggaagatcctgctg
aaggggaagaagctcggggggctcctgccccctgcaggggagggtggccctgaggccact
gtggtgtcagacgaagacgaggctgctgagatggaggatgaggcagtgaggagccgtgtg
cagcacaagcccaaggaggacaagctcaggctagcacaggagctctctgacatggtcatt
tactgcaagagtgtccactttgggggcttctccagtcctggcacccctgggcaggccttc
tacgagatggcgtccttctctgagaaccgtgcccttcgactgctccaagaatcaggaaac
ggctttgtccgccacaacgtggggcacctgagcagaatctacccggctggatggagaaca
gactcctccaactacagccccgtggagatgtggaatgggggctgccagatcgtggccctg
aatttccagacacctgggccagagatggacgtgtaccagggccgcttccaggacaacggg
gcctgtgggtacgtgctgaagcccgccttcctgcgagaccccaacggcacctttaacccc
cgcgccctggctcaggggccctggtgggcacggaagcggctcaacatcagggtcatttcg
gggcagcagctgccaaaagtcaacaagaataagaattcaattgtggaccccaaagtgaca
gtggagatccatggcgtgagccgggacgtggccagccgccagactgctgtcatcaccaac
aatggtttcaacccatggtgggacacggagtttgcgtttgaggtagttgtgcctgacctt
gccctcgtccgcttcttggtggaagattatgatgcctcctccnagaatgacttcattggc
cagagtaccatccccttgaacagcctcaagcaaggtgagtgtcaagagaagtggatgcac
gcataccacaccttgtatgggctgcctgcttttactgacacacacaagatgaccagaaga
ctctga

DBGET integrated database retrieval system