KEGG   Pan troglodytes (chimpanzee): 460365Help
Entry
460365            CDS       T01005                                 

Gene name
LAMB2
Definition
(RefSeq) laminin, beta 2 (laminin S)
  KO
K06243  
laminin, beta 2
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    460365 (LAMB2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    460365 (LAMB2)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    460365 (LAMB2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    460365 (LAMB2)
   05222 Small cell lung cancer
    460365 (LAMB2)
  Infectious diseases
   05146 Amoebiasis
    460365 (LAMB2)
   05145 Toxoplasmosis
    460365 (LAMB2)
Cell adhesion molecules and their ligands [BR:ptr04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     Laminin-11 Extracellular matrix (ECM) components
      460365 (LAMB2)
   VLA-6
      460365 (LAMB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 1776 aa AA seqDB search
MELTSRERGRGQPLPWELRLGLLLSVLAATLAQAPAPDVPGCSRGSCYPATGDLLVGRAD
RLTASSTCGLNGPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPHSHRIQNVVTSFAPQRR
TAWWQSENGIPVVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRYFSY
DCGADFPGVPLAPPRHWDDVVCESRYSEIEPSTESEVRTGIWAGDFPDSPLRVLFARLDP
RREIRVKXWYAIYEXFVRGNCFWYGHASECAPAPGAPAHAEGMVHGACICKHNTRGLNCE
QCQDFYRDLPWHPAEDGHSHACRKCECHGHTHSCHFDMAVYLASGNVSGGVCDGCQHNTA
GRHCELCRPFFYRDPTKDLRDPAVCRSCDCDPMGSQDGGRCDSHDDPALGLVSGQCRCKE
HVVGTRCQQCRDGFFGLSISDPLGCRRCQCNARGTVPGSTPCDPNSGSCYCKRLVTGRGC
DRCLPGHWGLSHDLLGCRPCDCDVGGALDPQCDEGTGQCHCRQHMVGRRCEQVQPGYFRP
FLDHLIWEAEDTRGQVLDVVERLVTPGETPSWTGSGFVRLQEGQTLEFLVASVPKAMDYD
LLLRLEPQVPEQWAELELIVQRPGPVPAHSLCGHLVPKDDRIQGTLQPHARYLIFPNPVC
LEPGISYKLHLKLIRTGGSAQPETPYSGPGLLIDSLVLLPRVLVLEMFSGGDAAALERQA
TFERYQCHEEGLVPSKTSPSEACAPLFISLSTLIYNGALPCQCNPQGSLSSECNPHGGQC
LCKPGVVGRRCDLCAPGYYGFGPTGCQACQCSHEGALSSLCEKTSGQCLCRTGAFGLRCD
RCQRGQWGFPSCRPCVCNGHADECNTHTGACLGCRDHTGGEHCERCIAGFHGDPRLPYGG
QCRPCPCPEGPGSQRHFATSCHRDEYSQQIVCHCRAGYTGLRCEACAPGHFGDPSRPGGR
CQLCECSGNIDPMDPDACDPHTGQCLRCLHHTEGPHCAHCKPGFHGQAARQSCHRCTCNL
LGTNPQQCPSPDQCHCDPSSGQCPCLPNVQGPSCDRCAPNFWNLTSGHGCQPCACHPSRA
RGPTCNEFTGQCHCRAGFGGRTCSECQELHWGDPGLQCRACDCDSRGIDTPQCHRFTGHC
SCRPGVSGVRCDQCARGFSGIFPACHPCHACFGDWDRVVQDLAARTRRLEQRAQELQQTG
VLGAFESSFWHMQEKLGIVQGIVGARNTSAASTAQLVEATEELRREIEEATEHLTQLEAE
LTDVQDENFNANHALSGLERDTLALNLTLRQLDQHLDLLKHSNFLGAYDSIRHAHSQSAE
AERRANTSALAVPSPVSNSASARHRTEALMDAQKEDFNSKHMANQRALGKLSAHTHTLSL
TDINELVCGAPGDAPCATSPCGGAGCRDEDGQPRCGGLSCNGAAATADLALGRARHTQAE
LQRALAEGGSILSRVAETRRQASEAQQRAQAALDKANASRGQVEQANQELRELIQSVKDF
LNQEGADPDSIEMVATRVLELSIPASAEQIQHLAGAIAERVRSLADVDAILARTVGDVRR
AEQLLQDARRARSWAEDEKQKAETVQAALEEAQRAQGIAQGAIRGAVADTRDTEQTLYQV
QERMAGAEQALSSAGERARQLDALLEALKLKRAGNSLAASTAEEMAGSAQGRAQEAEQLL
RGPLGDQYQTVKALAERKAQGVLAAQARAEQLRDEARDLLQAAQDKLQRLQELEGTYEEN
ERALESKAAQLDGLEARMRSVLQAINLQVQIYNTCQ
NT seq 5331 nt NT seq  +upstreamnt  +downstreamnt
atggagctgacctcaagggaaagagggaggggacagcctctgccctgggaacttcgactg
ggcctactgctaagcgtgctggctgccacactggcacaggcccctgccccggatgtgcct
ggctgttccaggggaagctgctaccccgccacgggcgacctgctggtgggccgagctgac
agactgactgcctcatccacttgtggcctgaatggcccccagccctactgcatcgtcagt
cacctgcaggacgaaaagaagtgcttcctttgtgactcccggcgccccttctctgctaga
gacaacccacacagccatcgcatccagaatgtagtcaccagctttgcaccacagcggcgg
acagcctggtggcagtcagagaatggtatccctgtggtcaccatccagctggacctggag
gctgagtttcatttcacacacctcattatgaccttcaagacatttcgccctgctgccatg
ctggtggaacgctcagcagactttggccgcacctggcatgtgtaccgatatttctcctat
gactgtggggctgacttcccaggagtcccactagcccccccacggcactgggatgatgta
gtctgtgagtcccgctactcagagattgagccatccactgaaagcgaggtgaggactggc
atctgggctggggatttccctgattcgccactgcgcgtgctttttgctagactcgaccca
cgcagagagatccgagtgaagtaatggtatgccatttatgagtaatttgttcggggtaat
tgcttttggtacggacacgcctcagagtgtgcacccgccccaggggcaccagcccatgct
gagggcatggtgcacggagcttgcatctgcaaacacaacacacgtggcctcaactgcgag
cagtgtcaggatttctatcgtgacctgccctggcatccggctgaggacggccatagtcat
gcctgtaggaagtgtgagtgccatgggcacacccacagctgccacttcgacatggccgta
tacctggcatctggcaatgtgagtggaggtgtgtgtgatggatgtcagcataacacagct
gggcgccactgtgagctctgtcggcccttcttctaccgtgacccaaccaaggacctgcgg
gatccggctgtgtgccgctcctgtgattgtgaccccatgggttctcaagacggtggtcgc
tgtgattcccatgatgaccctgcactgggactggtctccggccagtgtcgctgcaaagaa
catgtggtgggcactcgctgccagcaatgccgtgatggcttctttgggctcagcatcagt
gaccctctgggctgccggcgatgtcaatgtaatgcacggggcacagtgcctgggagcact
ccttgtgaccccaacagtggatcctgttactgcaaacgtctagtgactggacgtggatgt
gaccgctgcctgcctggccactggggcctgagccacgacctgctcggctgccgcccctgt
gactgcgacgtgggtggtgctttggatccccagtgtgatgagggcacaggtcaatgccac
tgccgccagcacatggttgggcgacgttgtgagcaggtgcaacctggctacttccggccc
ttcctggaccacctaatttgggaggctgaggacacccgagggcaggtgctcgatgtggtg
gagcgcctggtgacccccggggaaactccatcctggactggctcaggctttgtgcggcta
caggaaggtcagaccctggagttcctggtggcctctgtgccgaaggctatggactatgac
ctgctgctgcgcttagagccccaggtccctgagcaatgggcagagttggaactgattgtg
cagcgtccagggcccgtgcctgcccacagcctgtgtgggcatttggtgcccaaggatgat
cgcatccaagggactctgcaaccacacgccaggtacttgatatttcctaatcctgtctgc
cttgagcctggtatctcctacaagctgcatctgaagctgatacggacagggggaagtgcc
cagcctgagactccctactctggacctggcctgctcattgactcgctggtgctgctgccc
cgtgtcctggtgctagagatgtttagtgggggtgatgctgctgccctggagcgccaggcc
acctttgaacgctaccaatgccatgaggagggtctggtgcccagcaagacttctccctct
gaggcctgtgcacccctcttcatcagcctgtccaccctcatctacaatggtgccctgcca
tgtcagtgcaaccctcaaggttcactgagttctgagtgcaaccctcatggtggtcagtgc
ctgtgcaagcctggagtggttgggcgccgctgtgacctctgtgcccctggctactatggc
tttggccccacaggctgtcaagcctgccagtgcagccacgagggggcactcagcagtctc
tgtgaaaagaccagtgggcaatgtctctgtcgaactggtgcctttgggcttcgctgtgac
cgctgccagcgtggccagtggggattccctagctgccggccatgtgtctgcaatgggcat
gcagatgagtgcaacacccacacaggcgcttgcctgggctgccgtgatcacacagggggt
gagcactgtgaaaggtgcattgctggtttccacggggacccacggctgccatatgggggc
cagtgccggccctgtccctgtcctgaaggccctgggagccaaaggcactttgctacttct
tgccaccgggatgaatattcccagcagattgtgtgccactgccgggcaggctatacgggg
ctgcgatgtgaagcttgtgcccctgggcactttggggacccatcaaggccaggtggccgg
tgccaactgtgtgagtgcagtgggaacattgacccaatggatcctgatgcctgtgacccc
cacacggggcaatgcctgcgctgtttacaccacacagagggtccacactgtgcccactgc
aagcctggcttccatggacaggctgcccgacagagctgtcaccgctgcacatgcaacctg
ctgggcacaaatccgcagcagtgcccatctcctgaccagtgccactgtgatccaagcagt
gggcagtgcccatgcctccccaatgtccagggccctagctgtgaccgctgtgcccccaac
ttctggaacctcaccagtggccatggttgccagccttgtgcctgccacccaagccgggcc
agaggccccacctgcaatgagttcacagggcagtgccactgccgtgccggctttggaggg
cggacttgttctgagtgccaagagctccactggggagaccctgggttgcagtgccgtgcc
tgtgattgtgactctcgtggaatagatacacctcagtgtcaccgcttcacaggtcactgc
agctgccgcccaggcgtgtctggtgtgcgctgtgaccagtgtgcccgcggcttctcagga
atctttcctgcctgccatccctgccatgcatgcttcggggattgggaccgagtggtgcag
gacttggctgcccgtacacggcgcctagagcagcgggcgcaggagttgcaacagacgggt
gtgctgggtgcctttgagagcagcttctggcatatgcaggagaagctgggcattgtgcag
ggcatcgtaggtgcccgcaacacctcagccgcctccactgcacagcttgtggaggccaca
gaggagctgcggcgtgaaattgaggaggccactgagcacctgactcagctcgaggcagag
ctgacagatgtgcaagatgagaacttcaatgccaaccatgcactaagtggtctggagcga
gatacgcttgcacttaatctcacactgcggcagctcgaccagcatcttgacttgctcaaa
cattcaaacttcctgggtgcctatgacagcatccggcatgcccatagccagtctgcagag
gcagaacgtcgtgccaatacctcagccctggcagtacctagccctgtgagcaactcggca
agtgctcggcatcggacagaggcactgatggatgctcagaaggaggacttcaacagcaaa
cacatggccaaccagcgggcacttggcaagctctctgcccatacccacaccctgagcctg
acagacataaatgagctggtgtgtggggcaccaggggatgcaccctgtgctacaagccct
tgtgggggtgccggctgtcgagatgaggatgggcagccccgctgtgggggcctcagttgc
aatggggcagcggctacagcagacctagcactgggccgggcccggcacacacaggcagag
ctgcagcgggcactggcagaaggtggtagcatcctcagcagagtggctgagactcgtcgg
caggcaagcgaggcacagcagcgggcccaggcagccctggacaaggctaatgcttccagg
ggacaggtggaacaggccaaccaggaacttcgagaacttatccagagtgtgaaggacttc
ctcaaccaggagggggctgatcctgatagcattgaaatggtggccacacgggtgctagag
ctctccatcccagcttcagctgagcagatccagcacctggcgggtgcgattgcagagcga
gtccggagcctggcagatgtggatgcgatcctggcacgtactgtaggagatgtgcgtcgt
gccgagcagctactgcaggatgcacggcgggcaaggagctgggctgaggatgagaaacag
aaggcagagacagtacaggcagcactggaggaggcccagcgggcacagggtattgcccag
ggtgccatccggggggcagtggctgacacacgggacacagagcagaccctgtaccaggta
caggagaggatggcaggtgcagagcaggcactgagctctgcaggtgaaagggctcggcag
ttggatgctctcctggaggctctgaaattgaaacgggcaggaaatagtctggcagcctct
acagcagaagaaatggcaggcagtgcccagggtcgtgcccaggaggctgagcagctgcta
cggggtcctctgggtgatcagtaccagacggtgaaggccctagctgagcgcaaggcccaa
ggtgtgctggctgcacaggcaagggcagaacaactgcgggatgaggctcgggacctgttg
caagccgctcaggacaagctgcagcggctacaggaattggaaggcacctatgaggaaaat
gagcgggcactggagagtaaggcagcccagttggacgggttggaggccaggatgcgcagc
gtgcttcaagccatcaacttgcaggtgcagatctacaacacctgccagtga

DBGET integrated database retrieval system