KEGG   Pan troglodytes (chimpanzee): 460367Help
Entry
460367            CDS       T01005                                 

Gene name
USP4
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 4 isoform X2
  KO
K11835  ubiquitin carboxyl-terminal hydrolase 4/11 [EC:3.4.19.12]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     460367 (USP4)
Peptidases [BR:ptr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   460367 (USP4)
Ubiquitin system [BR:ptr04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    460367 (USP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH Ubiquitin_3 DUSP UCH_1 USP7_C2 USP7_ICP0_bdg CW_binding_1
Motif
Other DBs
NCBI-GeneID: 460367
NCBI-ProteinID: XP_001163407
Ensembl: ENSPTRG00000014920
UniProt: K7CG48
Position
3
AA seq 915 aa AA seqDB search
MAEGGGCRERPDAETQKSELGALMRTTLQRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVG
EHNLFPGPIDNSGLFSDPESQTLKEHLIDELDYVLVPTEAWNKLLNWYGCVEGQQPIVRK
VVEHGLFVKHCKVEVYLLELKLCENSDPTNVLSCHFSKADTIATIEKEMRKLFNIPAERE
TRLWNKYMSNTYEQLSKLDNTVQDAGLYQGQVLVIEPQNEDGTWPRQTLQSNGSGFSASY
NCQEPPSSHIQPGLCGLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINRDNPLGM
KGEIAEAYAELIKQMWSGRDAHVAPRMFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHE
DLNRVKKKPYLELKDANGRPDAVVAKEAWENHRLRNDSVIVDTFHGLFKSTLVCPECAKV
SVTFDPFCYLTLPLPLKKDRVMEVFLVPADPHCRPTQYRVTVPLMGAVSDLCEALSRLSG
IAAENMVVADVYNHRFHKIFQMDEGLNHIMPRDDIFVYEVCSTSVDGSECVTLPVYFRER
KSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPLEPG
ACNGSRNSCEGEDEEEMEHQEEGKEQLSETEGSGEDEPGNDPSETTQKIKGQPCPKRLFT
FSLVNSYGTADINSLAADGKLLKLNSRSTLAMDWDSETRRLYYDEQESEAYEKHVSMLQP
QKKKKTTVALRDCIELFTTMETLGEHDPWYCPNCKKHQQATKKFDLWSLPKILVVHLKRF
SYNRYWRDKLDTVVEFPIRGLNMSEFVCNLSARPYVYDLIAVSNHYGAMGVGHYTAYAKN
KLNGKWYYFDDSNVSLASEDQIVTKAAYVLFYQRRDDEFYKTPSLSSSGSSDGGTRPSSS
QQGLGDDEACSMDTN
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaggtggaggctgccgtgagcgaccggatgcggagactcagaagtccgagctt
ggagccttaatgaggaccacactccaacgcggggcgcagtggtatcttattgacagccgg
tggttcaagcagtggaagaagtatgtgggctttgacagctgggacatgtacaatgtgggt
gaacataacctatttcctggcccaatagacaactctgggctattttcagatcctgagagt
cagaccttgaaagaacacttaattgatgaattggactatgtattggtccccaccgaggcg
tggaataaactactaaactggtacggctgtgtagaaggccagcaacccatcgtcagaaaa
gttgtggagcatggcctgtttgtcaagcactgcaaagtcgaggtgtatttgctggaacta
aagctctgtgagaacagtgaccccaccaatgtgctgagttgccatttcagcaaggcagac
accattgcaaccatcgagaaagagatgcggaagctattcaacatccctgcggagcgtgaa
acacggctctggaacaaatacatgagcaacacctacgagcagttgagcaagctagacaac
actgtccaggatgctgggctataccagggtcaggtgctagtaattgagcctcaaaatgaa
gatggcacatggcccaggcagaccttgcagtcaaatggatctggcttttctgcttcgtat
aattgtcaggagccaccatcctctcatatacaacctgggctctgtggacttggaaacctg
ggaaacacctgcttcatgaactccgctttgcagtgtttgagcaacactgcaccactgact
gactactttctcaaagatgagtatgaagctgaaatcaacagagacaaccctctggggatg
aaaggggaaattgcagaagcctatgccgaactcattaagcagatgtggtctggaagggac
gcccatgtggcacctcgcatgttcaaaactcaagtgggacgttttgctcctcaattttct
ggctaccagcaacaagattctcaggagctgctggcctttcttctagatggattgcatgaa
gatctgaaccgggtaaagaaaaagccctacttggagctgaaggatgccaatgggcggcca
gatgcggtggtggcaaaggaagcctgggagaatcacaggttgaggaatgattctgtgatt
gtggatactttccatggcctcttcaaatctactttggtttgcccagaatgtgctaaggtt
tctgtgacctttgacccattttgctatctaacgctgccactgcccttgaagaaagatcga
gttatggaggttttcctggttcctgctgaccctcactgcagacctactcagtaccgtgtg
actgtgccgctgatgggggctgtgtccgacctgtgcgaggctctctccaggctgtctggc
attgctgcagaaaatatggtggtcgcagatgtgtataatcaccgattccacaaaattttc
caaatggatgaaggtttaaaccacatcatgcctcgggatgacattttcgtgtacgaggtc
tgcagcacttccgtggatggctcggaatgtgtcacgcttccagtctacttcagggagagg
aagtccaggccatcaagcacttcctccgcatcagcgctatatgggcagccactattgctt
tctgtccccaagcacaagttaacccttgagtctttgtaccaggctgtttgtgatcgtatc
agccgctatgtgaaacagcctttaccggatgagtttggcagctcacccttggagccaggg
gcctgcaatggctccaggaacagctgtgaaggagaagatgaggaagaaatggagcatcag
gaagaaggcaaagagcagctttcagaaacagaaggcagtggggaagatgagccaggaaat
gaccccagtgagaccacccaaaagatcaaaggccagccctgcccaaaaaggctttttacc
ttcagtcttgtgaactcctatggaacagctgacataaattcacttgcagctgatggaaaa
ctacttaaactcaactctcgatctacactggccatggattgggacagtgaaactcggaga
ctttactatgatgagcaagaatctgaggcctacgagaagcatgtgagcatgttgcagcct
cagaagaagaagaagaccacagtggccctgagagactgcatcgagctcttcaccaccatg
gagacccttggggagcatgacccctggtactgtcccaactgtaagaagcatcaacaggcc
acaaaaaagtttgacctatggtccttgcccaagatcctggtggtccacctcaaacgtttc
tcctacaacagatactggagggataagctcgacacagtcgtagaattcccaatcagaggg
ctgaacatgtccgagtttgtctgtaacctgtcagcaaggccttatgtgtacgacctcatt
gccgtgtccaatcattatggagccatgggggttggccactacactgcatatgcgaagaac
aaactgaatggtaaatggtattactttgatgatagcaacgtgtccctggcctctgaggat
cagatagtgactaaagcagcttatgtgctattttaccaacgtcgagatgatgaattttat
aagacaccttcacttagcagttctggttcctctgatggagggacacgaccaagcagctct
cagcagggcttgggggatgatgaggcttgcagcatggacaccaactaa

DBGET integrated database retrieval system