KEGG   Pan troglodytes (chimpanzee): 460367Help
Entry
460367            CDS       T01005                                 

Gene name
USP4
Definition
ubiquitin specific peptidase 4 (proto-oncogene)
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     460367 (USP4)
Peptidases [BR:ptr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   460367 (USP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 915 aa AA seqDB search
MAEGGGCRERPDAETQKSELGALMRTTLQRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVG
EHNLFPGPIDNSGLFSDPESQTLKEHLIDELDYVLVPTEAWNKLLNWYGCVEGQQPIVRK
VVEHGLFVKHCKVEVYLLELKLCENSDPTNVLSCHFSKADTIATIEKEMRKLFNIPAERE
TRLWNKYMSNTYEQLSKLDNTVQDAGLYQGQVLVIEPQNEDGTWPRQTLQSNGSGFSASY
NCQEPPSSHIQPGLCGLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINRDNPLGM
KGEIAEAYAELIKQMWSGRDAHVAPRMFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHE
DLNRVKKKPYLELKDANGRPDAVVAKEAWENHRLRNDSVIVDTFHGLFKSTLVCPECAKV
SVTFDPFCYLTLPLPLKKDRVMEVFLVPADPHCRPTQYRVTVPLMGAVSDLCEALSRLSG
IAAENMVVADVYNHRFHKIFQMDEGLNHIMPRDDIFVYEVCSTSVDGSECVTLPVYFRER
KSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPLEPG
ACNGSRNSCEGEDEEEMEHQEEGKEQLSETEGSGEDEPGNDPSETTQKIKGQPCPKRLFT
FSLVNSYGTADINSLAADGKLLKLNSRSTLAMDWDSETRRLYYDEQESEAYEKHVSMLQP
QKKKKTTVALRDCIELFTTMETLGEHDPWYCPNCKKHQQATKKFDLWSLPKILVVHLKRF
SYNRYWRDKLDTVVEFPIRGLNMSEFVCNLSARPYVYDLIAVSNHYGAMGVGHYTAYAKN
KLNGKWYYFDDSNVSLASEDQIVTKAAYVLFYQRRDDEFYKTPSLSSSGSSDGGTRPSSS
QQGLGDDEACSMDTN
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaggtggaggctgccgtgagcgaccggatgcggagactcagaagtccgagctt
ggagccttaatgaggaccacactccaacgcggggcgcagtggtatcttattgacagccgg
tggttcaagcagtggaagaagtatgtgggctttgacagctgggacatgtacaatgtgggt
gaacataacctatttcctggcccaatagacaactctgggctattttcagatcctgagagt
cagaccttgaaagaacacttaattgatgaattggactatgtattggtccccaccgaggcg
tggaataaactactaaactggtacggctgtgtagaaggccagcaacccatcgtcagaaaa
gttgtggagcatggcctgtttgtcaagcactgcaaagtcgaggtgtatttgctggaacta
aagctctgtgagaacagtgaccccaccaatgtgctgagttgccatttcagcaaggcagac
accattgcaaccatcgagaaagagatgcggaagctattcaacatccctgcggagcgtgaa
acacggctctggaacaaatacatgagcaacacctacgagcagttgagcaagctagacaac
actgtccaggatgctgggctataccagggtcaggtgctagtaattgagcctcaaaatgaa
gatggcacatggcccaggcagaccttgcagtcaaatggatctggcttttctgcttcgtat
aattgtcaggagccaccatcctctcatatacaacctgggctctgtggacttggaaacctg
ggaaacacctgcttcatgaactccgctttgcagtgtttgagcaacactgcaccactgact
gactactttctcaaagatgagtatgaagctgaaatcaacagagacaaccctctggggatg
aaaggggaaattgcagaagcctatgccgaactcattaagcagatgtggtctggaagggac
gcccatgtggcacctcgcatgttcaaaactcaagtgggacgttttgctcctcaattttct
ggctaccagcaacaagattctcaggagctgctggcctttcttctagatggattgcatgaa
gatctgaaccgggtaaagaaaaagccctacttggagctgaaggatgccaatgggcggcca
gatgcggtggtggcaaaggaagcctgggagaatcacaggttgaggaatgattctgtgatt
gtggatactttccatggcctcttcaaatctactttggtttgcccagaatgtgctaaggtt
tctgtgacctttgacccattttgctatctaacgctgccactgcccttgaagaaagatcga
gttatggaggttttcctggttcctgctgaccctcactgcagacctactcagtaccgtgtg
actgtgccgctgatgggggctgtgtccgacctgtgcgaggctctctccaggctgtctggc
attgctgcagaaaatatggtggtcgcagatgtgtataatcaccgattccacaaaattttc
caaatggatgaaggtttaaaccacatcatgcctcgggatgacattttcgtgtacgaggtc
tgcagcacttccgtggatggctcggaatgtgtcacgcttccagtctacttcagggagagg
aagtccaggccatcaagcacttcctccgcatcagcgctatatgggcagccactattgctt
tctgtccccaagcacaagttaacccttgagtctttgtaccaggctgtttgtgatcgtatc
agccgctatgtgaaacagcctttaccggatgagtttggcagctcacccttggagccaggg
gcctgcaatggctccaggaacagctgtgaaggagaagatgaggaagaaatggagcatcag
gaagaaggcaaagagcagctttcagaaacagaaggcagtggggaagatgagccaggaaat
gaccccagtgagaccacccaaaagatcaaaggccagccctgcccaaaaaggctttttacc
ttcagtcttgtgaactcctatggaacagctgacataaattcacttgcagctgatggaaaa
ctacttaaactcaactctcgatctacactggccatggattgggacagtgaaactcggaga
ctttactatgatgagcaagaatctgaggcctacgagaagcatgtgagcatgttgcagcct
cagaagaagaagaagaccacagtggccctgagagactgcatcgagctcttcaccaccatg
gagacccttggggagcatgacccctggtactgtcccaactgtaagaagcatcaacaggcc
acaaaaaagtttgacctatggtccttgcccaagatcctggtggtccacctcaaacgtttc
tcctacaacagatactggagggataagctcgacacagtcgtagaattcccaatcagaggg
ctgaacatgtccgagtttgtctgtaacctgtcagcaaggccttatgtgtacgacctcatt
gccgtgtccaatcattatggagccatgggggttggccactacactgcatatgcgaagaac
aaactgaatggtaaatggtattactttgatgatagcaacgtgtccctggcctctgaggat
cagatagtgactaaagcagcttatgtgctattttaccaacgtcgagatgatgaattttat
aagacaccttcacttagcagttctggttcctctgatggagggacacgaccaagcagctct
cagcagggcttgggggatgatgaggcttgcagcatggacaccaactaa

DBGET integrated database retrieval system