KEGG   Pan troglodytes (chimpanzee): 460426Help
Entry
460426            CDS       T01005                                 

Gene name
BAP1
Definition
BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase)
Orthology
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
ptr  Pan troglodytes (chimpanzee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 729 aa AA seqDB search
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLFKWIEERRSRR
KVSTLVDDTSVIDDDIVNNMFFAHQLIPNSCATHALLSVLLNCSNVDLGPTLSRMKDFTK
GFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSYVPITGRL
FELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIK
YEARLHVLKVNRQTVLEALQQLIRVTQPELIQTHKSQESQLPEESKSASNKSPLVLEANR
APAASEGNHTDGAEEAAGSCAQAPSHSPPNKPKLVVKPPGSSLNGVPPNPTPIVQRLPAF
LDNHNYAKSPMQEEEDLAAGVGRSRVPVRPPQQYSDDEDDYEDDEEDDVQNTNSALRYKG
KGTGKPGALSGSADGQLSVLQPNTINVLAEKLKESQKDLSIPLSIKTSSGAGSPAVAVPT
HSQPSPTPSNESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGEDDSLLR
VDCIRYNRAVRDLGPVISTGLLHLAEDGVLSPLALTEGGKGSSPSIRPIQGSQGSSSPVE
KEVVEATDSREKTGMVRPGEPLSGEKYSPKELLALLKCVEAEIANYEACLKEEVEKRKKF
KIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKPDRRKR
SRPYKAKRQ
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgaataagggctggctggagctggagagcgacccaggcctcttcaccctgctcgtggaa
gatttcggtgtcaaaggggtgcaagtggaggagatctacgaccttcagagcaaatgtcag
ggccctgtatatggatttatcttcctgttcaaatggatcgaagagcgccggtcccggcga
aaggtctctaccttggtggatgatacgtccgtgattgatgatgatattgtgaataacatg
ttctttgcccaccagctgatacccaactcttgtgcaactcatgccttgctgagcgtgctc
ctgaactgcagcaacgtggacctgggacccaccctgagtcgcatgaaggacttcaccaag
ggtttcagccctgagagcaaaggatatgcgattggcaatgccccggagttggccaaggcc
cataatagccatgccaggcccgagccacgccacctccctgagaagcagaatggccttagt
gcagtgcggaccatggaggcgttccactttgtcagctatgtgcctatcacaggccggctc
tttgagctggatgggctgaaggtctaccccattgaccatgggccctggggggaggacgag
gagtggacagacaaggcccggcgggtcatcatggagcgtatcggcctcgccactgcaggg
gagccctaccacgacatccgcttcaacctgatggcagtggtgcccgaccgcaggatcaag
tatgaggccaggctgcatgtgctgaaggtgaaccgtcagacagtactagaggctctgcag
cagctgataagagtaacacagccagagctgattcagacccacaagtctcaagagtcacag
ctgcctgaggagtccaagtcagccagcaacaagtccccgctggtgctggaagcaaacagg
gcccctgcagcctctgagggcaaccacacagatggtgcagaggaggcggctggttcatgc
gcacaagccccatcccacagccctcccaacaaacccaagctggtggtgaagcctccaggc
agcagcctcaatggggttccccccaaccccactcccattgtccagcggctgccggccttt
ctagacaatcacaattatgccaagtcccccatgcaggaggaagaagacctggcggcaggt
gtgggccgcagccgagttccagtccgcccaccccagcagtactcagatgacgaggatgac
tatgaggatgacgaggaggatgacgtgcagaacaccaactctgcccttaggtataagggg
aagggaacagggaagccaggggcattgagcggttctgctgatgggcaactgtcagtgctg
cagcccaacaccatcaacgtcttggctgagaagctcaaagagtcccagaaggacctctca
attcctctgtccatcaagactagcagcggggctgggagtccggctgtggcagtgcccaca
cactcgcagccctcacccacccccagcaatgagagtacagacacggcctctgagatcggc
agtgctttcaactcgccactgcgctcgcctatccgctcagccaacccgacgcggccctcc
agccctgttacctcccacatctccaaggtgctttttggagaggatgacagcctgctgcgt
gttgactgcatacgctacaaccgtgctgtccgtgatctgggtcctgtcatcagcacaggc
ctgctgcacctggctgaggatggggtgctgagtcccctggcgctgacagagggtgggaag
ggttcctcgccctctatcagaccaatccaaggcagccagggttccagcagcccagtggag
aaggaggtcgtggaagccacggacagcagagagaagacggggatggtgaggcctggcgag
cccttgagtggggagaaatactcacccaaggagctgctggcactgctgaagtgtgtggag
gctgagattgcaaactatgaggcgtgcctcaaggaagaagtagagaagaggaagaagttc
aagattgatgaccagagaaggacccacaactacgatgagttcatctgcacctttatctcc
atgctggctcaggaaggcatgctggccaacctagtggagcagaacatctccgtgcggcgg
cgccaaggggtcagcatcggccggctccacaagcagcggaagcctgaccggcggaaacgc
tctcgcccctacaaggccaagcgccagtga

DBGET integrated database retrieval system