KEGG   Pan troglodytes (chimpanzee): 460457Help
Entry
460457            CDS       T01005                                 

Gene name
CACNA2D3
Definition
calcium channel, voltage-dependent, alpha 2/delta subunit 3
Orthology
K04860  
voltage-dependent calcium channel alpha-2/delta-3
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Oxytocin signaling pathway
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:ptr04010]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:ptr04921]
Organismal Systems; Circulatory system; Cardiac muscle contraction [PATH:ptr04260]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:ptr04261]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:ptr05410]
Human Diseases; Cardiovascular diseases; Arrhythmogenic right ventricular cardiomyopathy (ARVC) [PATH:ptr05412]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:ptr05414]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 1053 aa AA seqDB search
MAGPGSPRRASRGASALLAAALLYAALGDVVRSEQQIPLSVVKLWASAFGGEIKSIAAKY
SGSQLLQKKYKEYEKDVAIEEIDGLQLVKKLAKNMEEMFHKKSEAVRRLVEAAEEAHLKH
EFDADLQYEYFNAVLINERDKDGNFLELGKEFILAPNDHFNNLPVNISLSDVQVPTNMYN
KDPAIVNGVYWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQYPGIKWEPDENGVIAFD
CRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAYNEE
LHYVEPCLNGTLVQADRTNKEHFREHLDKLFAKGIGMLDIALNEAFNILSDVRIFTYLIG
REAAFADNLKWMACANKGFFTQISTLADVQENVMEYLHVLSRPKVIDQEHDVVWTEAYID
STLPQAQKLTDDQGPVLMTTVAMPVFSKQNETRSKGILLGVVGTDVPVKELLKTIPKYKL
GIHGYAFAITNNGYILTHPELRLLYEEGKKRRKPNYSSVDLSEVEWEDRDDVLRNAMVNR
KTGKFSMEVKKTVDKGKRVLVMTNDYYYTDIKGTPFSLGVALSRGHGKYFFRGNVTIEEG
LHDLEHPDVSLADEWSYCNTDLHPEHRHLSQLEAIKLYLKGKEPLLQCDKELIQEVLFDA
VVSAPIEAYWTSLALNKSENSDKGVEVAFLGTRTGLSRINLFVGAEQLTNQDFLKAGDKE
NIFNADHFPLWYRRAAEQIPGSFVYSIPFSTGPVNKSNVVTASTSIQLLDERKSPVVAAV
GIQMKLEFFQRKFWTASRQCASLDGKCSISCDDETVNCYLIDNNGFILVSEDYTQTGDFF
GEIEGAVMNKLLTMGSFKRITLYDYQAMCRANKESSDGAHGLLDPYNAFLSAVKWIMTEL
VLFLVEFNLCSWWHSDMTAKAQKLKQTLEPCDTEYPAFVSERTIKETTGNIACEDCSKSF
VIQQIPSSNLFMVVVDSSCLCESVAPITMAPIEIRYNESLKCERLKAQKIRRRPESCHGF
HPEENARECGGAPSLEAQTVLLLLPLLLMLFSR
NT seq 3162 nt NT seq  +upstreamnt  +downstreamnt
atggccgggccgggctcgccgcgccgcgcgtcccggggggcctcggcgcttctcgccgcc
gcgcttctctacgccgcgctgggggacgtggtgcgctcggagcagcagataccgctctcc
gtggtgaagctctgggcctcggcttttggtggggagataaaatccattgctgctaagtac
tccggttcccagcttctgcaaaagaaatacaaagagtatgagaaagacgttgccatagaa
gaaatcgatggcctccaactggtaaagaagctggcaaagaacatggaagagatgtttcac
aagaagtctgaggccgtcaggcgtctggtggaggctgcagaagaagcacacctgaaacat
gaatttgatgcagacttacagtatgaatacttcaatgctgtgctgataaatgaaagggac
aaagacgggaattttttggagctggggaaggaattcatcttagccccaaatgaccatttt
aataatttgcctgtgaacatcagtctaagtgacgtccaagtaccaacgaacatgtacaac
aaagaccctgcaattgtcaatggggtttattggtctgaatctctaaacaaagtttttgta
gataactttgaccgtgacccatctctcatatggcagtactttggaagtgcaaagggcttt
tttaggcagtatccggggattaaatgggaaccagatgagaatggagtcattgccttcgac
tgcaggaaccgaaaatggtacatccaggcagcaacttctccgaaagacgtggtcatttta
gttgacgtcagtggcagcatgaaaggactccgtctgactatcgcgaagcaaacagtctca
tccattttggatacacttggggatgatgacttcttcaacataattgcttataatgaggag
cttcactatgtggaaccttgcctgaatggaactttggtgcaagccgacaggacaaacaaa
gagcacttcagggagcatctggacaaacttttcgccaaaggaattggaatgttggatata
gctctgaatgaggccttcaacattctgagtgatgttcgcatcttcacatacctcattgga
cgagaggctgcgtttgcagacaatctaaagtggatggcctgtgccaacaaaggatttttt
acccagatctccaccttggctgatgtgcaggagaatgtcatggaataccttcacgtgctt
agccggcccaaagtcatcgaccaggagcatgatgtggtgtggaccgaagcttacattgac
agcactctccctcaggcacaaaagctgactgatgatcagggccccgtcctgatgaccact
gtagccatgcctgtgtttagtaagcagaacgaaaccagatcgaagggcattcttctggga
gtggttggcacagatgtcccagtcaaagaacttctgaagaccatccccaaatacaagtta
gggattcacggttatgcctttgcaatcacaaataatggatatatcctgacgcatccggaa
ctcaggctgctgtacgaagaaggaaaaaagcgaaggaaacctaactatagtagcgttgac
ctctctgaggtggaatgggaagaccgagatgacgtgttgagaaatgctatggtgaatcga
aagacggggaagttttccatggaggtgaagaagacagtggacaaagggaaacgggttttg
gtgatgacaaatgactactattatacagacatcaagggtactcctttcagtttaggtgtg
gcgctttccagaggtcatgggaaatatttcttccgagggaatgtaaccatcgaagaaggc
ctgcatgacttagaacatcccgatgtgtccttggcagatgaatggtcctactgcaacact
gacctacaccctgagcaccgccatctgtctcagttagaagcgattaagctctacctaaaa
ggcaaagaacctctgctccagtgtgataaagaattgatccaagaagtcctttttgacgcg
gtggtgagtgcccccattgaagcgtattggaccagcctggccctcaacaaatctgaaaat
tctgacaagggcgtggaggttgccttcctcggcactcgcacgggcctctccagaatcaac
ctgtttgtcggggctgagcagctcaccaatcaggacttcctgaaagctggcgacaaggag
aacatttttaacgcagaccatttccctctctggtaccgaagagccgctgagcagattcca
gggagcttcgtctactcgatcccgttcagcactggaccagtcaataaaagcaatgtggtg
acagcgagtacatccatccagctcctggatgaacggaaatctcctgtggtggcagctgta
ggcattcagatgaaacttgaatttttccaaaggaagttctggactgccagcagacagtgt
gcttccctggatggcaaatgctccatcagctgtgatgatgagactgtgaattgttacctc
atagacaataatggatttattttggtgtctgaagactacacacagactggagactttttt
ggtgagatcgagggagctgtgatgaacaaattgctaacaatgggctcctttaaaagaatt
accctttatgactaccaagccatgtgtagagccaacaaggaaagcagcgatggcgcccat
ggcctcctggatccttataatgccttcctctctgcagtaaaatggatcatgacagaactt
gtcttgttcctggtggaatttaacctctgcagttggtggcactccgatatgacagctaaa
gcccagaaattgaaacagaccctggagccttgtgatactgaatatccagcattcgtctct
gagcgcaccatcaaggagactacagggaatattgcttgtgaagactgctccaagtccttt
gtcatccagcaaatcccaagcagcaacctgttcatggtggtggtggacagcagctgcctc
tgtgaatctgtggcccccatcaccatggcacccattgaaatcaggtataatgaatccctt
aagtgtgaacgtctaaaggcccagaagatcagaaggcgcccagaatcttgtcatggcttc
catcctgaggagaatgcaagggagtgtgggggtgcaccgagtctcgaagcccagacagtc
ctccttctgctccctctgcttttgatgctcttctcaaggtga

DBGET integrated database retrieval system