KEGG   Pan troglodytes (chimpanzee): 460520Help
Entry
460520            CDS       T01005                                 

Gene name
GBE1
Definition
glucan (1,4-alpha-), branching enzyme 1
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ptr00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 818 aa AA seqDB search
MTSASRKKPLRGGKGRSLRPPGASRVSGRRGLGASYPLRTCVPASPRDPLLPAGGGRKGR
RPSVPAIKGPGPPRLASTRLGALRLRPSRRVPARAAAPAQAPLDPLGPRLLGLRRNMAAP
MTPAARPEDYEAALNAALADVPELARLLEIDPYLKPYAVDFQRRYKQFSQILKNIGENEG
GIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWEL
YIPPKQNKSVLVPHGSKLKVVITSKSGEILYRISPWAKYVVREGDNVNYDWIHWDPEHSY
EFKHSRPKKPRSLRIYESHVGISSHEGKVASYKHFTCNVLPRIKGLGYNCIQLMAIMEHA
YYASFGYQITSFFAASSRYGTPEELQELVDTAHSMGIIVLLDVVHSHASKNSADGLNMFD
GTDSCYFHSGPRGTHDLWDSRLFAYSSWEVLRFLLSNIRWWLEEYRFDGFRFDGVTSMLY
HHHGVGQGFSGDYSEYFGLQVDEDALTYLMLANHLVHTLCPDSITIAEDVSGMPALCSPI
SQGGGGFDYRLAMAIPDKWIQLLKEFKDEDWNMGDIVYTLTNRRYLEKCIAYAESHDQAL
VGDKSLAFWLMDAEMYTNMSVLTPFTPVIDRGIQLHKMIRLITHGLGGEGYLNFMGNEFG
HPEWLDFPRKGNNESYHYARRQFHLTDDDLLRYKFLNNFDRDMNRLEERYGWLAAPQAYV
SEKHEGNKVIAFERAGLLFIFNFHPSKSYTDYRVGTALPGKFKIVLDSDAAEYGGHQRLD
HSTDFFSEAFEHNGRPCSLLVYIPSRVALILQNVDLPN
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
atgacctccgccagcaggaaaaaaccgttaaggggaggaaagggcaggtccctgcggcct
ccaggtgccagccgcgtgagtgggcggagaggcctcggtgcctcctacccgctccggacg
tgcgtcccggcatcaccccgggatccgctcctccccgctggcggggggagaaagggcagg
aggccttccgtcccggctataaagggccccggaccgcctcggctcgcctcgacacgccta
ggcgccctccggctccgccctagccgccgcgtcccagctcgagctgcagcgcccgctcag
gccccactcgaccctctcgggcctcggctacttggactgcggcggaatatggcggctccg
atgactcccgcggctcggcccgaggactacgaggcggcgctcaatgccgccctggctgac
gtgcccgaactggccagactcctggagatcgacccgtacttgaagccctatgccgtggac
ttccagcgcaggtataagcagtttagccaaattttgaagaacattggagaaaatgaaggt
ggtattgataagttttccagaggctatgaatcatttggcgtccacagatgtgctgatggt
ggtttatactgcaaagaatgggccccgggagcagaaggagtttttcttactggagatttt
aatggttggaatccattttcgtacccatataaaaaactggattatggaaaatgggagctg
tatatcccaccaaagcagaataaatctgtactcgtgcctcatggatccaaattaaaggta
gttattactagtaaaagcggagagatcttgtatcgtatttcaccgtgggcaaagtatgtg
gttcgtgaaggtgataatgtgaattatgattggatacactgggatccagaacactcatat
gaatttaagcattccagaccaaagaagccacggagtctaagaatttatgaatctcatgtg
ggaatttcttcccatgaaggaaaagtagcttcttataaacattttacatgcaatgtacta
ccaagaatcaaaggccttggatacaactgcattcagttgatggcaatcatggagcatgct
tactatgccagctttggttaccaaatcacaagcttctttgcagcttccagccgttatgga
acacctgaagagctacaagaactggtagacacagctcattccatgggtatcatagtcctc
ttagatgtggtacacagccatgcttcaaaaaattcagcagacggattgaatatgtttgat
gggacagattcctgttattttcattctggacctagagggactcatgatctttgggatagc
agattgtttgcctactccagctgggaagttttaagattccttctgtcaaacataagatgg
tggttggaagaatatcgctttgatggatttcgttttgatggtgttacgtccatgctttat
catcaccatggagtgggtcaaggtttctcaggtgattacagtgaatatttcggactacaa
gtagatgaagatgccttgacttacctcatgttggcaaatcatttggttcacacgctgtgt
cccgattctataacaatagctgaggatgtatcaggaatgccagctctgtgctctccaatt
tcccagggagggggtggttttgactatcgactagccatggcaattccagataagtggatt
cagctacttaaagagtttaaagatgaagactggaacatgggcgatatagtatacacgctg
acaaacaggcgctaccttgaaaagtgcattgcttatgcagagagccatgatcaggcattg
gttggggataagtcgctggcattttggttgatggatgccgaaatgtatacaaacatgagt
gtcctgactccttttactccagttattgatcgtggaatacagcttcataaaatgattcga
ctcattacgcatgggcttggtggagaaggctatctcaatttcatgggtaatgaatttggg
catcctgaatggttagacttcccaagaaaaggaaataatgagagttaccattatgccagg
cggcagtttcatttaactgacgatgaccttcttcgctacaagttcctaaataattttgac
agggatatgaatagattggaagaaagatatggttggcttgcagctccacaggcctacgtg
agtgaaaaacatgaaggcaataaggtcattgcttttgaaagagcaggtcttcttttcatt
ttcaacttccatccaagcaagagctacactgactaccgagttggaacagcattgccaggg
aaattcaaaattgtgctagattcagatgcagcggaatatggagggcatcagagactggac
cacagcactgactttttttctgaggcttttgaacataatgggcgtccctgttctcttttg
gtgtacattccaagcagagtggccctcatccttcagaatgtggatctgccgaattga

DBGET integrated database retrieval system