KEGG   Pan troglodytes (chimpanzee): 460535Help
Entry
460535            CDS       T01005                                 

Gene name
DHFRL1
Definition
dihydrofolate reductase-like 1
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    460535 (DHFRL1)
   00670 One carbon pool by folate
    460535 (DHFRL1)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     460535 (DHFRL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 186 aa AA seqDB search
MFLLLNCIVAVSQNMGIGKNGDLPRPPLRNEFRYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLNDRINLVLSRELKEPPQGAHFFARSLDDALKLTERPELANKVDMIWIVGGSS
VYKEAMNHLGHLKLFVTRIMQDFESDTFFSEIDLEKYKLLPEYPGVLSDVQEGKHIKYKF
EVYEND
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttttgctaaactgcatcgtcgctgtgtcccaaaacatgggcatcggcaagaac
ggggacctgcccaggccgccgctcaggaatgaattcaggtatttccagagaatgaccaca
acttcttcagtagagggtaaacagaatctggtgattatgggtaggaagacctggttctcc
attcctgagaagaatcgacctttaaatgatagaattaatttagttctcagcagagaactc
aaggaacctccacaaggagctcatttttttgccagaagtttggatgatgccttaaaactt
actgaacgaccagaattagcaaataaagtagacatgatttggatagttggtggcagttct
gtttataaggaagccatgaatcacctaggccatcttaaactatttgtgacaaggatcatg
caggactttgaaagtgacacgtttttttcagaaattgacttggagaaatataaacttctg
cctgaatacccaggtgttctctctgatgtccaggaggggaaacacatcaagtacaaattt
gaagtatatgagaatgattaa

DBGET integrated database retrieval system