KEGG   Pan troglodytes (chimpanzee): 460655Help
Entry
460655            CDS       T01005                                 

Gene name
ALDH1L1
Definition
aldehyde dehydrogenase 1 family, member L1
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    460655 (ALDH1L1)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     460655 (ALDH1L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 1213 aa AA seqDB search
MALPETGLARISGNQEEGSAAPGQSRRERVEKGNCREKTRGCFSLGEAGRHWAGRSAAIH
PDAQLLRGRLCKRLQIPGGQRLLWLYCVRSTWQTRPERVRCAPAIVPPPVSAAPTRLTLR
PPRAPPLTGSGLNQSSRTGGDRSHLLAPRTGLHQPQFRGCGSQKSNLPGTPAPTPARGPS
NPPATMKIAVIGQSLFGQEVYCHLRKEGHEVVGVFTVPDKDGKADPLGLEAEKDGVPVFK
FSRWRAKGQALPDVVAKYQALGAELNVLPFCSQFIPMEIISAPRHGSIIYHPSLLPRHRG
ASAINWTLIHGDKKGGFSIFWADDGLDTGDLLLQKECEVLPDDTVSTLYNRFLFPEGIKG
MVQAVRLISEGKAPRLPQPEEGATYEGIQKKETAKINWDQPAEAIHNWIRGNDKVPGAWT
EACEQKLTFFNSTLNTSGLVPEGDALPIPGAHRPGVVTKAGLILFGNDDKMLLVKNIQLE
DGKMILASNFFKGAASSVLELTEAELVTAEAVRSVWQRILPNVLEVEDSTDFFKSGAASV
DVVRLVEEVKELCDGLELENEDVYMASTFGDFIQLLVRKLRGDDEEGECSIDYVEMAVNK
RTVRMPHQLFIGGEFVDAEGAKTSETINPTDGSVICQVSLAQVTDVDKAVAAAKDAFENG
RWGKISARDRGRLMYRLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAG
WCDKIQGMTATREVGCLVPAPTPQLCSFWLQLDPPRPGPSTCAQLLRAVGRGTPGPAPTL
TLSCSNVKARGFAALRNRKYRTKEEQAEDESRSAGGVRTPLDAKHRKLGSDLSRPYILIW
PQSWKPGFESGCQALGEVEGIGRSTVGLVEKKDKGQPLLCGRVCGIIIPWNYPLMMLSWK
TAACLAAGNTVVIKPAQVTPLTALKFAELTLKAGIPKGVVNVLPGSGPCHRGSQCPYLPW
RDRPHQPSVPCSCAISNVKKVSLELGGKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIA
AGRLFVEDSIHDEFVRRVVEEVRKMKVGNPLDRDTDHGPQNHHAHLVKLMEYCQCGVKEG
ATLVCGGNQVPRPGFFFEPTVFTDVEDHMFIAKEESFGPVMIISRFADGDVDAVLSRANA
TEFGLASGVFTRDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAAL
NEYLRVKTVTFEY
NT seq 3642 nt NT seq  +upstreamnt  +downstreamnt
atggccttgcctgagaccgggctggccaggatctctgggaaccaggaggaggggtctgcg
gcaccaggacagagtagaagggagagagtggagaaggggaattgcagagagaaaaccagg
ggctgtttttctctcggagaggcgggtaggcactgggcgggcagaagcgccgctatccac
ccggatgcgcagctgctaaggggccgcctctgcaagcggctgcaaattcccggagggcag
cgtctcctttggctctactgtgtccgtagcacatggcagacccgcccggagagggtgcgc
tgcgctcccgccatagtcccaccaccagtgagcgccgcccccactcggctgactctccgc
ccgccccgcgcccctcccctcacgggctctggccttaaccagagctcgcggactggcggg
gacaggtcccacctcctggctcccaggacgggtctacaccaacctcagtttcggggctgc
ggctcacagaagtctaacctgcccgggacgcccgcaccaactcctgcgcgcggtccttcc
aaccctcctgctaccatgaagattgcagtgattggacagagcctgtttggccaggaagtt
tactgccacctgaggaaggagggccacgaagtggtgggtgtgttcactgttccagacaag
gatggaaaggccgaccccctgggtctggaagctgagaaggatggagtgccagtattcaag
ttctcccggtggcgtgcaaaaggacaggctttgcctgatgtggtggcaaaataccaggct
ttgggggccgagctcaacgtcctgcccttctgcagccaattcatccccatggagataatc
agtgccccccggcatggctccatcatctatcacccgtcactgctccctaggcaccgaggg
gcctcggccatcaactggaccctcattcacggagataagaaaggggggttttccatcttc
tgggcggatgatggtctggacaccggagacctgctgctgcagaaggagtgtgaggtgctc
ccggacgacaccgtgagcacgctgtacaaccgcttcctcttccctgaaggcatcaaaggg
atggtgcaggccgtgaggctgatctctgagggcaaagcccccagactccctcagcctgag
gaaggagccacctatgaggggattcagaagaaggagaccgccaaaatcaactgggaccag
ccggcagaggccattcacaactggatccgcgggaatgacaaggtgccgggagcctggaca
gaggcctgtgaacagaaactgacatttttcaactcaacgctgaacacttcaggcctggtg
cccgagggagacgctttgcccatcccaggagcccatcggccaggggtggtcaccaaagca
ggactcatcctctttgggaatgatgacaaaatgctgctggtgaagaacattcagctggag
gatggcaaaatgatcctggcctcgaacttctttaagggggcagccagcagtgtccttgag
ctgacagaggcagagctggttactgcggaggctgtgcggagtgtttggcagcggatcctc
cccaatgtcctggaggttgaagactccactgatttcttcaagtcaggggccgcgtctgtg
gacgttgtgaggctggtggaggaagtgaaggagctgtgtgatggcctggagttagaaaat
gaagatgtgtacatggcatccacctttggggacttcatccagctgttagtgaggaagctg
cgaggggacgatgaggagggcgagtgcagcattgactacgtggaaatggcagtgaacaag
cgcactgtccgcatgccccaccagcttttcattgggggggagttcgtggatgccgagggc
gccaagacctctgagaccatcaatcccactgatggaagtgtcatctgccaggtatccctg
gcccaagtcaccgacgttgacaaggcagtggccgcagccaaggatgcctttgagaatgga
cggtgggggaagatcagcgcgcgggaccggggccggctgatgtacaggttggcagatctc
atggagcagcaccaggaggagctggccaccattgaggccctggatgcgggtgccgtctac
acgctggccctgaagacccacgtgggcatgtccatccagaccttccgctactttgctggc
tggtgtgacaagatccagggcatgacagcgacaagggaggtgggctgcctggtgcccgcc
cctactccgcagctgtgtagcttctggctgcagctggaccccccaaggcctgggccttct
acatgtgctcaactgcttagagctgtggggagggggacacccggccctgcccccaccctc
accctttcttgctcgaatgtcaaagctagaggctttgctgcactgaggaacaggaaatat
agaacaaaggaggaacaggcagaggacgagagccgctcagcaggaggagttcggaccccg
ctggatgccaagcataggaaactgggcagtgacctctcgaggccatacatcctgatttgg
ccccagtcctggaagcctggctttgagagtggatgtcaggccctgggtgaggtggaggga
attggcaggtccactgtgggcctggtggagaagaaggacaaaggccagcctcttttgtgt
ggcagggtttgtggcatcatcatcccctggaactatcccctgatgatgctgtcctggaag
acagctgcctgcctggctgccgggaacacagtggtgatcaagcctgctcaggtgacccca
ctcacagccttgaagtttgcagagctgacattaaaggccggcattcccaaaggtgtggtt
aacgtcctcccaggatctggtccctgccaccgggggtcccaatgcccctacctgccctgg
agggaccggccccaccagccctctgttccttgcagctgtgccataagtaacgtgaagaag
gtgtccctggaactgggcgggaagtcacccctcatcatctttgctgactgtgacctcaac
aaggctgtgcagatggggatgagttctgttttcttcaacaaaggagagaattgcattgca
gcaggccgactctttgtggaggactccattcatgatgagttcgtgcggagggtggtagaa
gaggtgcggaagatgaaggtgggcaacccgctggacagggacaccgaccacgggccgcag
aatcaccatgcccaccttgtgaagctgatggagtactgccagtgtggcgtgaaggaaggg
gccacactggtctgcggcgggaatcaagtccctcggccagggttcttctttgagccaact
gttttcacagacgtggaagaccacatgttcatagccaaggaggagtccttcgggcctgtc
atgatcatctctcggtttgctgatggggacgtggatgccgtgctgtctcgggccaatgcc
acggaatttggcctggcttctggtgtcttcaccagggacatcaacaaggccctgtatgtc
agtgacaagctccaggcaggcactgtgtttgtcaacacgtacaacaagaccgacgtggct
gctcccttcggaggattcaaacagtctggatttggcaaagatctaggagaggcagctctg
aacgagtacctgcgggtcaagacagtgaccttcgaatactga

DBGET integrated database retrieval system