KEGG   Pan troglodytes (chimpanzee): 460673Help
Entry
460673            CDS       T01005                                 

Gene name
RPN1
Definition
ribophorin I (EC:2.4.99.18)
Orthology
K12666  
oligosaccharyltransferase complex subunit alpha (ribophorin I)
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Protein processing in endoplasmic reticulum
Module
Oligosaccharyltransferase
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:ptr00510]
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:ptr04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 607 aa AA seqDB search
MEAPAARLFLLLLLGTWAPAPGSASSEAPPLINEDVKRTVDLSSHLAKVTAEVVLAHLGG
GSTSRATSFLLALEPELEARLAHLGVQVKGEDEEENNLEVRETKIKGKSGRFFTVKLPVA
LDPGAKISVIVETVYTHVLQPYPTQITQSEKQFVVFEGNHYFYSPYPTRTQTMRVKLASR
NVESYTKLGNPTRSEDLLDYGPFRDVPAYSQDTFKVHYENNSPFLTITSMTRVIEVSHWG
NIAVEENVDLKHTGAVLKGPFSRYDYQRQPDSGISSIRSFKTILPAAAQDVYYRDEIGNV
STSHLLILDDSVEMEIRPRFPLFGGWKTHYIVGYNLPSYEYLYNLGDQYALKMRFVDHVF
DEQVIDSLTVKIILPEGAKNIEIDSPYEISRAPDELHYTYLDTFGRPVIVAYKKNLVEQH
IQDIVVHYTFNKVLMLQEPLLVVAAFYILFFTVIIYVRLDFSITKDPAAEARMKVACITE
QVLTLVNKRIGLYRHFDETVNRYKQSRDISTLNSGKKSLETEHKALTSEISLLQSRLKTE
GSDLCDRVSEMQKLDAQVKELVLKSAVEAERLVAGKLKKDTYIENEKLISGKRQELVTKI
DHILDAL
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgccagccgcccgcttgtttctgctcctgttgcttgggacttgggccccggcg
ccaggcagcgcctcctccgaggcaccgccgctgatcaatgaggacgtgaagcgcacagtg
gacctaagcagccacctggctaaggtgacggccgaggtggtcctggcgcacctgggcggc
ggctccacgtcccgagctacctctttcctgctggctttggagcctgagctcgaggcccgg
ctggcgcacctgggcgtgcaggtaaagggagaagatgaggaagagaacaatttggaagta
cgtgaaaccaaaattaagggtaaaagtgggagattcttcacagtcaagctcccagttgct
cttgatcctggggccaagatttcagtcattgtggaaacagtctacacccatgtgcttcag
ccgtatccaacccagatcacccagtcagagaaacagtttgtggtgtttgaggggaaccat
tatttctactctccctatccaacgaggacacaaaccatgcgtgtgaagcttgcctctcga
aatgtggagagctacaccaagctggggaaccccacgcgctctgaggacctactggattat
gggcctttcagagatgtgcctgcctatagtcaggatacttttaaagtacattatgagaac
aacagccctttcctgaccatcaccagcatgacccgagtcattgaagtctctcactggggt
aatattgctgtggaagaaaatgtggacttaaagcacacaggagctgtgcttaaggggcct
ttctcacgctatgattaccagagacagccagatagtggaatatcctccatccgttctttt
aagaccatccttcctgctgctgcccaggatgtttattaccgggatgagattggcaatgtt
tccaccagccacctccttattttggatgactctgtagagatggaaatccggcctcgcttc
cctctctttggcgggtggaagacccattacatcgttggctacaacctcccaagctatgag
tacctctataatttgggtgaccagtatgcactgaagatgaggtttgtggaccatgtgttt
gatgaacaagtgatagattctctgactgtgaagatcatcctgcctgaaggagccaagaac
attgaaattgatagtccctatgaaatcagccgtgccccagatgagctgcactacacctat
ctggacacatttggccgccctgtgattgttgcctacaagaaaaatctggtagaacagcac
attcaggacattgtggtccactacacgttcaacaaggtgctcatgctgcaggagcccctg
ctggtggtggcggccttctacatcctgttcttcaccgttatcatctatgttcggctggac
ttctccatcaccaaggatccagccgcagaagccaggatgaaggtagcctgcatcacagag
caggtcttgaccctggtcaacaagagaataggcctttaccgtcactttgacgagaccgtc
aataggtacaagcaatcccgggacatctccaccctcaacagtggcaagaagagcctggag
actgaacacaaggccttgaccagtgagatttcactgctgcagtccaggctgaagacagag
ggctctgatctgtgcgacagagtgagcgaaatgcagaagctggatgcacaggtcaaggag
ctggtgctgaagtcggcggtggaggctgagcgcctggtggctggcaagctcaagaaagac
acgtacattgagaatgagaagctcatctcaggaaagcgccaggagctggtcaccaagatc
gaccacatcctggatgccctgtag

DBGET integrated database retrieval system