KEGG   Pan troglodytes (chimpanzee): 460763Help
Entry
460763            CDS       T01005                                 

Gene name
CPB1
Definition
carboxypeptidase B1 (tissue)
Orthology
K01291  
carboxypeptidase B [EC:3.4.17.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Pancreatic secretion
Protein digestion and absorption
Class
Organismal Systems; Digestive system; Pancreatic secretion [PATH:ptr04972]
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:ptr04974]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 417 aa AA seqDB search
MLALLVLVNVALASAHHGGEHFEGEKVFRVNVEDENHINIIRELASTTQIDFWKPDSVTQ
IKPHSTVDFRVKAEDTVTVENVLKQNELQYKVLINNLRNVVEAQFDSRVRATGHSYEKYN
KWETIEAWTQQVATENPALISRSVIGTTFEGRAIYLLKVGKAGQNKPAIFMDCGFHAREW
ISPAFCQWFVREAVRTYGHEIQVTELLDKLDFYVLPVLNIDGYIYTWTKSRLWRKTRSTH
AGSSCIGTDPNRNFDAGWCEIGASQNPCAETYCGPAAESEKETKALADFIRNKLSSIKAY
LTIHSYSQMMIYPYSYAYKLGENNAELNALAKATVKELASLHGTKYTYGPGATTIYPAAG
GSDDWAYDQGIRYSFTFELRDTGRYGFLLPESQIRATCEETFLAIKYVASYVLEHLY
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgttggcgctcttggttctggtgaatgtggccctggcatctgctcatcatggtggtgag
cactttgaaggcgagaaggtgttccgtgttaacgttgaagatgaaaatcacattaacata
atccgcgagttggccagcacgacccagattgacttctggaagccagattctgtcacacaa
atcaaacctcacagtacagttgacttccgtgttaaagcagaagatactgtcactgtggag
aatgttctaaagcagaatgaactacaatacaaggtactgataaacaacctgagaaatgtg
gtggaggctcagtttgatagccgggttcgtgcaacaggacacagttatgagaagtacaac
aagtgggaaacgatagaggcttggactcaacaagtcgccactgagaatccagccctcatc
tctcgcagtgttatcggaaccacatttgagggacgcgctatttacctcctcaaggttggc
aaagctggacaaaataagcctgccattttcatggactgtggtttccatgccagagagtgg
atttctcctgcattctgccagtggtttgtaagagaggctgttcgtacctatggacatgag
atccaagtgacagagcttctcgacaagttagacttttatgtcctgcctgtgctcaatatt
gatggctacatctacacctggaccaagagccgattatggagaaagactcgctccacccat
gctggatctagctgcattggcacagaccccaacagaaattttgatgctggttggtgtgaa
attggagcctctcaaaacccctgtgctgaaacttactgtggacctgctgcagagtctgaa
aaggagaccaaggccctggctgatttcatccgcaacaaactctcttccatcaaggcatat
ctgacaatccactcatactcccaaatgatgatctacccttactcatatgcttacaaactc
ggtgagaacaatgctgagttgaatgccctggctaaagctactgtgaaagaacttgcctca
ctgcacggcaccaagtacacatatggcccgggagctacaacaatctatcctgctgctggg
ggctctgacgactgggcttacgaccaaggaatcagatattccttcacctttgaacttcga
gatacaggcagatatggctttctccttccagaatcccagatccgggctacctgtgaggag
accttcctggcaatcaagtatgttgccagctacgtcctggaacacctgtactag

DBGET integrated database retrieval system