KEGG   Pan troglodytes (chimpanzee): 460970Help
Entry
460970            CDS       T01005                                 

Gene name
BDH1
Definition
3-hydroxybutyrate dehydrogenase, type 1
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ptr00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:ptr00072]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 256 aa AA seqDB search
MKDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKAVEIVRSSLKDPEKGMWGLVNNAGI
STFGEVEFTSLETYKQVAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSMLGRMANPARSP
YCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESIQAIAKKMWDELPEV
VRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQ
IMTHLPGAISDMIYIR
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacaaaggccatgatggggtcaaggagctggacagcctaaacagtgaccgattg
agaaccgtccagctcaatgtctgcagcagcgaagaggtggagaaagcggtggagattgtc
cgctcgagcctgaaggaccctgagaaagggatgtggggcctcgttaacaatgccggcatc
tcaacgttcggggaggtggagttcaccagcctggagacctacaagcaggtggcagaagtg
aacctttggggcacagtgcggatgacgaaatcctttctccccctcatccgaagggccaaa
ggccgcgtcgtcaatatcagcagcatgctgggccgcatggccaacccggcccgctccccg
tactgcatcaccaagttcggggtagaggctttctcggactgcctgcgctatgagatgtac
cccctgggcgtgaaggtcagcgtggtggagcccggcaacttcatcgctgccaccagcctt
tacagccctgagagcattcaggccatcgccaagaagatgtgggacgagctgcctgaggtc
gtgcgcaaggactacggcaagaagtactttgatgaaaagatcgccaagatggagacctac
tgcagcagtggctccacagacacgtcccctgtcatcgatgctgtcacacacgccctgacc
gccaccaccccctacacccgctaccaccccatggactactactggtggctgcgaatgcag
atcatgacccacttgcctggagccatctccgacatgatctacatccgctga

DBGET integrated database retrieval system