KEGG   Pan troglodytes (chimpanzee): 460996Help
Entry
460996            CDS       T01005                                 

Gene name
EHHADH
Definition
enoyl-CoA, hydratase/3-hydroxyacyl CoA dehydrogenase
Orthology
K07514  
enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
PPAR signaling pathway
Peroxisome
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
beta-Oxidation
Class
Metabolism; Overview; Carbon metabolism [PATH:ptr01200]
Metabolism; Overview; Fatty acid metabolism [PATH:ptr01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ptr00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ptr00650]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:ptr00071]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:ptr00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ptr00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:ptr00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:ptr00410]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:ptr04146]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:ptr03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 627 aa AA seqDB search
MAFGGGLELALGCHYRIAHAEAQVGLPEVTLGLLPGARGTQLLPRLTGVPASLDLITSGR
RILADEALKLGILDKVVNSDPVEEAIRFAQRVSDQPLESRRLCNKPIQSLPNMDSIFSEA
LLKMRRQHPGCLAQEACVRAVQAAVQYPYEVGIKKEEELFLYLLQSGQARALQYAFFAER
KANKWSTPSGASWKTASARPVSSVGVVGLGTMGRGIVISFARARIPVIAVDSDKNQLATA
NKMITSVLEKEASKMQQSGHPWSGPKPRLTSSMKELGGVDLVIEAVFEEMSLKKQVFAEL
SAVCKPEAFLCTNTSALDVDEIASSTDRPHLVIGTHFFSPAHVMKLLEVIPSQYSSPTTI
ATVMNLSKKIKKIGVVVGNCFGFVGNRMLNPYYNQAYFLLEEGSKPEEVDQVLEEFGFKM
GPFRVSDLAGLDVGWKSRKGQGLTGPTLPPGTPARKRGNRRYCPIPDVLCELGRFGQKTG
KGWYQYDKPLGRIHKPDPWLSKFLSQYRETHHIEPRTISQDEILERCLYSLINEAFRILG
EGIAASPEHIDVVYLHGYGWPRHKGGPMFYASTVGLPTVLEKLQKYYRQNPDIPQLEPSD
YLKKLASQGNPPLKEWQSLAGSPSSKL
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggctttcggagggggactagagctggccctgggctgtcactataggattgcccacgca
gaggctcaagttggcttaccagaagttacactgggacttctccctggtgcaagaggaacc
cagcttctccccagactcactggagttcctgcttcacttgacttaattacctcaggaaga
cgtattttagcagatgaagcactcaagctgggcattctagataaagttgtaaactcagac
ccggttgaagaagcaatcagatttgctcagagagtttcagatcaacctctagaatcccgt
agactctgcaacaagccaattcagagcttgcccaacatggacagcatttttagtgaggcc
ctcttgaagatgcggaggcagcaccctgggtgtcttgcacaggaggcttgtgtccgtgca
gtccaggctgctgtgcagtatccctatgaagtgggcatcaagaaggaggaggagctgttt
ctatatcttttgcaatcagggcaggctagagccctgcaatatgctttcttcgctgaaagg
aaagcaaataagtggtcaactccctccggagcatcgtggaaaacagcatcagcgcggcct
gtctcctcagttggtgttgttggcttgggaacaatgggccgaggcattgtcatttctttt
gcaagggccaggattcctgtgattgctgtagactcggacaaaaaccagctagcaactgca
aacaagatgataacctctgtcttggaaaaagaagcctccaaaatgcaacagagcggccac
ccttggtcaggaccaaaacccaggttaacttcatctatgaaggagcttggtggtgtagat
ttagtcattgaagcagtatttgaggaaatgagcctgaagaagcaggtctttgctgaactc
tcagctgtgtgcaaaccagaagcatttttgtgcactaatacttcagccctggatgttgat
gagattgcttcttccactgatcgtcctcacttggtcattggcacccacttcttttcgcca
gctcatgtcatgaagttgttagaggttattcccagccaatactcttcccccactaccatt
gccactgttatgaacttatcaaaaaagattaaaaagattggagtcgttgtaggcaactgt
tttggatttgtggggaatcgaatgttgaatccttattacaatcaggcatatttcttgtta
gaagaaggcagcaaaccagaggaggtagatcaggtgctggaagagtttggttttaaaatg
gggccttttagagtgtctgatcttgctgggttggatgtgggctggaaatctagaaagggg
caaggtcttactggacctacattgcctccaggaactcctgcccgaaaaaggggtaatagg
aggtactgcccaattcctgatgtgctctgtgaattaggacgatttggccagaagacaggt
aagggttggtatcaatatgacaagccattgggtaggattcacaaacctgatccctggctt
tccaaattcctatcacagtatagagaaacccatcacattgaaccacgtaccattagccag
gatgagatcctcgagcgctgcttatattcacttatcaatgaagcattccgtatcttggga
gaagggatagctgctagcccagagcacattgatgttgtctatttacatggatatggatgg
ccaaggcacaagggcgggcccatgttctatgcttccacagttgggttgcccacagttcta
gagaaattgcagaaatattacaggcagaaccctgatattccccaactggagccaagtgac
tatctaaaaaaactggcttctcagggaaaccctcccctgaaagaatggcaaagcttggca
ggctcccctagcagtaaattgtga

DBGET integrated database retrieval system