KEGG   Pan troglodytes (chimpanzee): 460996Help
Entry
460996            CDS       T01005                                 

Gene name
EHHADH
Definition
enoyl-CoA, hydratase/3-hydroxyacyl CoA dehydrogenase
Orthology
K07514  
enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
PPAR signaling pathway
Peroxisome
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    460996 (EHHADH)
   01212 Fatty acid metabolism
    460996 (EHHADH)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    460996 (EHHADH)
   00650 Butanoate metabolism
    460996 (EHHADH)
  Lipid metabolism
   00071 Fatty acid degradation
    460996 (EHHADH)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    460996 (EHHADH)
   00310 Lysine degradation
    460996 (EHHADH)
   00380 Tryptophan metabolism
    460996 (EHHADH)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    460996 (EHHADH)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    460996 (EHHADH)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    460996 (EHHADH)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     460996 (EHHADH)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     460996 (EHHADH)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     460996 (EHHADH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 627 aa AA seqDB search
MAFGGGLELALGCHYRIAHAEAQVGLPEVTLGLLPGARGTQLLPRLTGVPASLDLITSGR
RILADEALKLGILDKVVNSDPVEEAIRFAQRVSDQPLESRRLCNKPIQSLPNMDSIFSEA
LLKMRRQHPGCLAQEACVRAVQAAVQYPYEVGIKKEEELFLYLLQSGQARALQYAFFAER
KANKWSTPSGASWKTASARPVSSVGVVGLGTMGRGIVISFARARIPVIAVDSDKNQLATA
NKMITSVLEKEASKMQQSGHPWSGPKPRLTSSMKELGGVDLVIEAVFEEMSLKKQVFAEL
SAVCKPEAFLCTNTSALDVDEIASSTDRPHLVIGTHFFSPAHVMKLLEVIPSQYSSPTTI
ATVMNLSKKIKKIGVVVGNCFGFVGNRMLNPYYNQAYFLLEEGSKPEEVDQVLEEFGFKM
GPFRVSDLAGLDVGWKSRKGQGLTGPTLPPGTPARKRGNRRYCPIPDVLCELGRFGQKTG
KGWYQYDKPLGRIHKPDPWLSKFLSQYRETHHIEPRTISQDEILERCLYSLINEAFRILG
EGIAASPEHIDVVYLHGYGWPRHKGGPMFYASTVGLPTVLEKLQKYYRQNPDIPQLEPSD
YLKKLASQGNPPLKEWQSLAGSPSSKL
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggctttcggagggggactagagctggccctgggctgtcactataggattgcccacgca
gaggctcaagttggcttaccagaagttacactgggacttctccctggtgcaagaggaacc
cagcttctccccagactcactggagttcctgcttcacttgacttaattacctcaggaaga
cgtattttagcagatgaagcactcaagctgggcattctagataaagttgtaaactcagac
ccggttgaagaagcaatcagatttgctcagagagtttcagatcaacctctagaatcccgt
agactctgcaacaagccaattcagagcttgcccaacatggacagcatttttagtgaggcc
ctcttgaagatgcggaggcagcaccctgggtgtcttgcacaggaggcttgtgtccgtgca
gtccaggctgctgtgcagtatccctatgaagtgggcatcaagaaggaggaggagctgttt
ctatatcttttgcaatcagggcaggctagagccctgcaatatgctttcttcgctgaaagg
aaagcaaataagtggtcaactccctccggagcatcgtggaaaacagcatcagcgcggcct
gtctcctcagttggtgttgttggcttgggaacaatgggccgaggcattgtcatttctttt
gcaagggccaggattcctgtgattgctgtagactcggacaaaaaccagctagcaactgca
aacaagatgataacctctgtcttggaaaaagaagcctccaaaatgcaacagagcggccac
ccttggtcaggaccaaaacccaggttaacttcatctatgaaggagcttggtggtgtagat
ttagtcattgaagcagtatttgaggaaatgagcctgaagaagcaggtctttgctgaactc
tcagctgtgtgcaaaccagaagcatttttgtgcactaatacttcagccctggatgttgat
gagattgcttcttccactgatcgtcctcacttggtcattggcacccacttcttttcgcca
gctcatgtcatgaagttgttagaggttattcccagccaatactcttcccccactaccatt
gccactgttatgaacttatcaaaaaagattaaaaagattggagtcgttgtaggcaactgt
tttggatttgtggggaatcgaatgttgaatccttattacaatcaggcatatttcttgtta
gaagaaggcagcaaaccagaggaggtagatcaggtgctggaagagtttggttttaaaatg
gggccttttagagtgtctgatcttgctgggttggatgtgggctggaaatctagaaagggg
caaggtcttactggacctacattgcctccaggaactcctgcccgaaaaaggggtaatagg
aggtactgcccaattcctgatgtgctctgtgaattaggacgatttggccagaagacaggt
aagggttggtatcaatatgacaagccattgggtaggattcacaaacctgatccctggctt
tccaaattcctatcacagtatagagaaacccatcacattgaaccacgtaccattagccag
gatgagatcctcgagcgctgcttatattcacttatcaatgaagcattccgtatcttggga
gaagggatagctgctagcccagagcacattgatgttgtctatttacatggatatggatgg
ccaaggcacaagggcgggcccatgttctatgcttccacagttgggttgcccacagttcta
gagaaattgcagaaatattacaggcagaaccctgatattccccaactggagccaagtgac
tatctaaaaaaactggcttctcagggaaaccctcccctgaaagaatggcaaagcttggca
ggctcccctagcagtaaattgtga

DBGET integrated database retrieval system