KEGG   Pan troglodytes (chimpanzee): 461015Help
Entry
461015            CDS       T01005                                 

Gene name
GPX1
Definition
glutathione peroxidase 1 (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    461015 (GPX1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    461015 (GPX1)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    461015 (GPX1)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     461015 (GPX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 201 aa AA seqDB search
MCAARLAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDYTQMNEL
QRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGA
HPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRR
FQTIDIEPDIEALLSQGPSCA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgctgctcggctagcggcggcggcggcccagtcggtgtatgccttctcggcgcgc
ccgctggccggcggggagcctgtgagcctgggctccctgcggggcaaggtactacttatc
gagaacgtggcgtccctctgaggcaccacggtccgggactacacccagatgaacgagctg
cagcggcgcctcggaccccggggcctggtggtgctcggcttcccgtgcaaccagtttggg
catcaggagaacgccaagaacgaagagattctgaattccctcaagtacgtccggcctggt
ggtgggttcgagcccaacttcatgctcttcgagaagtgcgaggtgaacggtgcgggggcg
caccctctcttcgccttcctgcgggaggccctgccagctcccagcgacgacgccactgcg
cttatgaccgaccccaagctcatcacctggtctccggtgtgtcgcaacgatgttgcctgg
aactttgagaagttcctggtgggccctgacggtgtgcccctacgcaggtacagccgccgc
ttccagaccattgacatcgagcctgacatcgaagccctgctgtctcaagggcccagctgt
gcctag

DBGET integrated database retrieval system