KEGG   Pan troglodytes (chimpanzee): 461066Help
Entry
461066            CDS       T01005                                 

Gene name
TACC3
Definition
(RefSeq) transforming acidic coiled-coil containing protein 3
  KO
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    461066 (TACC3)
Messenger RNA biogenesis [BR:ptr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     461066 (TACC3)
   mRNA cycle factors
    P-body specific factors
     461066 (TACC3)
Chromosome [BR:ptr03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   TACC proteins
    461066 (TACC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
4
AA seq 842 aa AA seqDB search
MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSVLHVSQKENVPPKNLAKAMKVTFQTP
LRDPQTHRILSPSMASKLEAPFTQDDTLGLENSHPVWTQKENQQLIKEVDAKTTHGILQK
PVEADTDLLGDASPAFGSGSSSESGPGALADLDCSSSSQSPGSSENQMVSPGKVSGSPEQ
AVEENLSSYSLDRRVTPTSETLEDPCRTESQHKAETPHGAEEECKAETPHGAEEECRHGG
VCAPTAVATSPPGAIPKEACGGAPLQGLPGEALACPAGVGTPVPADGTQTLTCAHTSAPE
STAPTNHLVAGRAMTLSPQEEVAAGQMASSSRSGPVKLEFDVSDGATSKRAPPPRRLGER
SGLKPPLRKAAARQQKAPQEVEEDDSRSGAGEDPPMPASRGSYHLDWDKMDDPNFSPFGG
DTKSGCSEAQPPESPETRLGQPAAEQLSAGPATEEPGPCLSQQLHSASAEDTPVVQLAAE
TPTAESKERALNSASTSLPTSCPVSEPVPTHQQGQPALELKEESFRDPAEVLGTGAEVDY
LEQFGTSSFKESALRKQSLYLKFDPLLRDSPRRPVPVATETSSMHGANETPSGRPREAKL
VEFDFLGALDIPVPGPPPGVPAPGGPPLSTGPIVDLLQYSQKDLDAVVRMQVKATQEENR
ELRSRCEELHGKNLELGKIMDRFEEVVYQAMEEVQKQKELSKAEIQKVLKEKDQLTTDLN
SMEKSFSDLFKRFEKQKEVIEGYRKNEESLKKCVEDYLARITQEGQRYQALKAHAEEKLQ
LANEEIAQVRSKAQAEALALQASLRKEQMRIQSLEKTVEQKTKENEELTRICDDLISKME
KI
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgcaggtcttaaacgacaaaaatgtcagcaatgaaaaaaatacagaaaattgc
gacttcctgttttcgccaccagaagttaccggaagatcgtctgttcttcatgtgtcacag
aaagaaaatgtgccacccaagaacctggccaaagctatgaaggtgacttttcagacacct
ctgcgggatccacagacgcacaggattctaagtcctagcatggccagcaaacttgaggct
cctttcactcaggatgacacccttggactggaaaactcacacccggtctggacacagaaa
gagaaccaacagctcatcaaggaagtggatgccaaaactactcatggaattctacagaaa
ccagtggaggctgacaccgacctcctgggggatgcaagcccagcctttgggagtggcagc
tccagcgagtctggccccggtgccctggctgacctggactgctcaagctcttcccagagc
ccaggaagttctgagaaccaaatggtgtctccaggaaaagtgtctggcagccctgagcaa
gccgtggaggaaaaccttagttcctattccttagacagaagagtgacacccacctctgag
accctagaagacccttgcaggacagagtcccagcacaaagcggagactccgcacggagcc
gaggaagaatgcaaagcggagactccgcacggagccgaggaagaatgccggcacggtggg
gtctgtgctcccacagcagtggccacttcgcctcctggtgcaattcctaaggaagcctgc
ggaggagcacccctgcagggtctgcctggcgaagccctggcctgccctgcgggtgtgggc
acccccgtgccagcagatggcactcagacccttacctgtgcacacacctctgctcctgag
agcacagccccaaccaaccacctggtggctggcagggccatgaccctgagtcctcaggaa
gaagtggccgcaggccaaatggccagctcctcgaggagcggacccgtaaaactagaattt
gatgtatctgatggcgccaccagcaaaagggcacccccaccaaggagactgggagagagg
tccggcctcaagcctcccttgaggaaagcagcagcgaggcagcaaaaggccccgcaggag
gtggaggaggatgacagtaggagcggagcgggagaggacccccccatgccggcttctcgg
ggctcttaccacctcgactgggacaaaatggatgacccaaacttcagcccgttcggaggt
gacaccaagtctggttgcagtgaggcccagcccccagaaagccctgagaccaggctgggc
cagccagcggctgaacagctgagtgctgggcctgccacggaggagccaggtccctgtctg
agccagcagctgcattcagcctcagcggaggacacgcctgtggtgcagttggcagccgag
accccaacagcagagagcaaggagagagccttgaactctgccagcacctcgcttcccaca
agctgtccagtcagtgagccagtgcccacccatcagcaggggcagcctgccttggagctg
aaagaggagagcttcagagaccccgctgaggttctaggcacgggcgcggaggtggattac
ctggagcagtttggaacttcctcgtttaaggagtcagccttgaggaagcagtccttatac
ctcaagttcgaccccctcctgagggacagtcctcgtagaccagtgcccgtggccaccgag
accagcagcatgcacggtgcaaatgagactccctcaggacgtccgcgggaagccaagctt
gtggagttcgatttcttgggagcactggacattcctgtgccaggcccacccccaggtgtc
cccgcacctgggggcccacccctgtccaccggacctatagtggacctgctccagtacagc
cagaaggacctggatgcagtggtaaggatgcaggtaaaggcgacacaggaggagaaccgg
gagctgaggagcaggtgtgaggagctccacgggaagaacctggaactggggaagatcatg
gacaggttcgaagaggttgtgtaccaggccatggaggaagttcagaagcagaaggaactt
tccaaagctgaaatccagaaagttctaaaagaaaaagaccaacttaccacagatctgaac
tccatggagaagtccttctccgacctcttcaagcgttttgagaaacagaaagaggtgatc
gagggctaccgcaagaacgaagagtcactgaagaagtgcgtggaggattacctggcgagg
atcacccaggaaggccagaggtaccaagccctgaaggcccacgcggaggagaagctgcag
ctggcaaacgaggagatcgcccaggtccggagcaaggcccaggcggaagcgttggccctc
caggccagcctgaggaaggagcagatgcggatccagtcgctggagaagacagtggagcag
aagactaaagagaacgaggagctgaccaggatctgcgacgacctcatctccaagatggag
aagatctga

DBGET integrated database retrieval system