KEGG   Pan troglodytes (chimpanzee): 461217Help
Entry
461217            CDS       T01005                                 

Gene name
PRKG2
Definition
protein kinase, cGMP-dependent, type II
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Gap junction
Circadian entrainment
Long-term depression
Olfactory transduction
Salivary secretion
Class
Cellular Processes; Cell communication; Gap junction [PATH:ptr04540]
Organismal Systems; Digestive system; Salivary secretion [PATH:ptr04970]
Organismal Systems; Nervous system; Long-term depression [PATH:ptr04730]
Organismal Systems; Sensory system; Olfactory transduction [PATH:ptr04740]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:ptr04713]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 733 aa AA seqDB search
MGNGSVKPKHSKHPDGHSGNLTTDALRNKVTELERELRRKDAEIQEREYHLKELREQLSK
QTVAIAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDKVPLEVHRKTSGLVSLHSRRG
AKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDM
VECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNC
TRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIID
CLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKAL
ISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKRS
MSNWKLSKALSLEMIQLKEKVKVKNENVAFAMKCIRKKHIVDTKQQEHVYSEKRILEELC
SPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHR
LGIIYRDLKPENLILDAEGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDF
SVDFWSLGILVYELLTGNPPFSGVDQMMTYNLILKGIEKMDFPRKITRRPEDLIRRLCRQ
NPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLQRELKGPIDHSYFDKYPPEKG
MPPDELSGWDKDF
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatggttcagtgaaacctaaacattccaagcacccagatggacactctgggaac
ctcaccactgatgctctgcggaacaaggtgacagagctggagagagagttgaggaggaag
gatgctgagatccaggagcgggagtaccatttgaaggagctgcgggagcagctgtcgaag
cagactgtggccattgctgaactcacagaggagctccagaacaagtgcatccagctgaac
aagctgcaggatgtggtgcatatgcagggaggaagcccgcttcaggcctcaccagataaa
gtgcctcttgaggtccaccggaagacctctggattggtctctctccatagcaggagggga
gcaaaggctggcgtgtctgctgagccaacaacccggacctatgacctgaacaaaccccct
gaattttcctttgagaaagcaagagtcagaaaagactccagtgagaagaagctcattaca
gatgcccttaataaaaatcagtttctgaaaagactggatcctcagcagatcaaagacatg
gtggaatgcatgtatgggagaaactatcagcaagggagttacattattaagcaaggagaa
ccaggaaaccatatctttgtgctggcagagggtcgactagaggtgttccaaggggagaaa
ttgctgtcctccatccctatgtggaccacatttggggagcttgccattttatacaactgt
acaaggactgcctctgtgaaagctattaccaatgttaaaacgtgggcactagatcgagag
gtattccagaatataatgaggagaacagcccaagctagagatgaacaatacagaaacttc
ctcagaagtgtatccttgctgaagaatttacctgaagataaattaaccaagatcattgac
tgcttggaagtggaatactatgacaaaggagattacatcattagagagggcgaggaagga
agtacctttttcattttggcaaaaggaaaggtaaaagtaacacagagcacagaaggccat
gatcaaccacagctgataaaaacactgcagaaaggagaatactttggagaaaaagctctt
atcagtgatgatgtcaggtcagctaacattattgctgaagaaaatgatgttgcatgcctg
gttatagatcgagaaacattcaaccaaactgtcggtacatttgaagagctgcaaaaatac
cttgaaggatatgtggcaaacctgaaccgtgatgatgaaaaaagacatgcgaagcggtcc
atgtctaactggaagctgtccaaagcactctctctggaaatgattcagctgaaggagaag
gttaaagtaaaaaatgagaatgttgcttttgctatgaagtgtataaggaagaagcacata
gttgacaccaagcagcaggagcatgtctactcagagaagaggatcctagaggagctgtgc
tctccattcattgtgaaattatatcgtactttcaaggacaataagtatgtatacatgctt
ctggaggcctgcttaggtggggagctctggagtatattaagggacagaggcagctttgat
gaacccacctccaaattctgcgttgcttgtgtgacagaagcatttgattacctgcatcga
ctaggtattatctacagagacttgaaaccagaaaacttaattctagatgctgagggttac
cttaaattggttgactttggatttgcgaagaaaatagggtctggacagaaaacatggaca
ttctgtgggactccagaatatgtagctcctgaagtcattctcaacaagggacatgacttc
agtgtggatttctggtcactgggaattctagtgtatgagctcctaacgggcaacccaccc
ttttctggggttgaccaaatgatgacctacaatttgattctcaaaggaattgaaaaaatg
gattttcccaggaagataacacgacgacctgaggatttgattcggaggctttgcaggcaa
aatccaacagaaaggctgggaaatctgaagaatggaataaatgacattaagaaacacagg
tggttaaatggttttaattgggagggactgaaagcacggagccttccatcacctttgcaa
agagagctcaagggacccatagatcacagctactttgacaaatatcctcctgaaaaggga
atgcctccagatgagctatcaggctgggataaagacttctga

DBGET integrated database retrieval system