KEGG   Pan troglodytes (chimpanzee): 461217Help
Entry
461217            CDS       T01005                                 

Gene name
PRKG2
Definition
protein kinase, cGMP-dependent, type II
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
cGMP-PKG signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Long-term depression
Olfactory transduction
Salivary secretion
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    461217 (PRKG2)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    461217 (PRKG2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    461217 (PRKG2)
  Digestive system
   04970 Salivary secretion
    461217 (PRKG2)
  Nervous system
   04730 Long-term depression
    461217 (PRKG2)
  Sensory system
   04740 Olfactory transduction
    461217 (PRKG2)
  Environmental adaptation
   04713 Circadian entrainment
    461217 (PRKG2)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     461217 (PRKG2)
Protein kinases [BR:ptr01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   461217 (PRKG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 733 aa AA seqDB search
MGNGSVKPKHSKHPDGHSGNLTTDALRNKVTELERELRRKDAEIQEREYHLKELREQLSK
QTVAIAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDKVPLEVHRKTSGLVSLHSRRG
AKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDM
VECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNC
TRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIID
CLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKAL
ISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKRS
MSNWKLSKALSLEMIQLKEKVKVKNENVAFAMKCIRKKHIVDTKQQEHVYSEKRILEELC
SPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHR
LGIIYRDLKPENLILDAEGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDF
SVDFWSLGILVYELLTGNPPFSGVDQMMTYNLILKGIEKMDFPRKITRRPEDLIRRLCRQ
NPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLQRELKGPIDHSYFDKYPPEKG
MPPDELSGWDKDF
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatggttcagtgaaacctaaacattccaagcacccagatggacactctgggaac
ctcaccactgatgctctgcggaacaaggtgacagagctggagagagagttgaggaggaag
gatgctgagatccaggagcgggagtaccatttgaaggagctgcgggagcagctgtcgaag
cagactgtggccattgctgaactcacagaggagctccagaacaagtgcatccagctgaac
aagctgcaggatgtggtgcatatgcagggaggaagcccgcttcaggcctcaccagataaa
gtgcctcttgaggtccaccggaagacctctggattggtctctctccatagcaggagggga
gcaaaggctggcgtgtctgctgagccaacaacccggacctatgacctgaacaaaccccct
gaattttcctttgagaaagcaagagtcagaaaagactccagtgagaagaagctcattaca
gatgcccttaataaaaatcagtttctgaaaagactggatcctcagcagatcaaagacatg
gtggaatgcatgtatgggagaaactatcagcaagggagttacattattaagcaaggagaa
ccaggaaaccatatctttgtgctggcagagggtcgactagaggtgttccaaggggagaaa
ttgctgtcctccatccctatgtggaccacatttggggagcttgccattttatacaactgt
acaaggactgcctctgtgaaagctattaccaatgttaaaacgtgggcactagatcgagag
gtattccagaatataatgaggagaacagcccaagctagagatgaacaatacagaaacttc
ctcagaagtgtatccttgctgaagaatttacctgaagataaattaaccaagatcattgac
tgcttggaagtggaatactatgacaaaggagattacatcattagagagggcgaggaagga
agtacctttttcattttggcaaaaggaaaggtaaaagtaacacagagcacagaaggccat
gatcaaccacagctgataaaaacactgcagaaaggagaatactttggagaaaaagctctt
atcagtgatgatgtcaggtcagctaacattattgctgaagaaaatgatgttgcatgcctg
gttatagatcgagaaacattcaaccaaactgtcggtacatttgaagagctgcaaaaatac
cttgaaggatatgtggcaaacctgaaccgtgatgatgaaaaaagacatgcgaagcggtcc
atgtctaactggaagctgtccaaagcactctctctggaaatgattcagctgaaggagaag
gttaaagtaaaaaatgagaatgttgcttttgctatgaagtgtataaggaagaagcacata
gttgacaccaagcagcaggagcatgtctactcagagaagaggatcctagaggagctgtgc
tctccattcattgtgaaattatatcgtactttcaaggacaataagtatgtatacatgctt
ctggaggcctgcttaggtggggagctctggagtatattaagggacagaggcagctttgat
gaacccacctccaaattctgcgttgcttgtgtgacagaagcatttgattacctgcatcga
ctaggtattatctacagagacttgaaaccagaaaacttaattctagatgctgagggttac
cttaaattggttgactttggatttgcgaagaaaatagggtctggacagaaaacatggaca
ttctgtgggactccagaatatgtagctcctgaagtcattctcaacaagggacatgacttc
agtgtggatttctggtcactgggaattctagtgtatgagctcctaacgggcaacccaccc
ttttctggggttgaccaaatgatgacctacaatttgattctcaaaggaattgaaaaaatg
gattttcccaggaagataacacgacgacctgaggatttgattcggaggctttgcaggcaa
aatccaacagaaaggctgggaaatctgaagaatggaataaatgacattaagaaacacagg
tggttaaatggttttaattgggagggactgaaagcacggagccttccatcacctttgcaa
agagagctcaagggacccatagatcacagctactttgacaaatatcctcctgaaaaggga
atgcctccagatgagctatcaggctgggataaagacttctga

DBGET integrated database retrieval system