KEGG   Pan troglodytes (chimpanzee): 461285Help
Entry
461285            CDS       T01005                                 

Gene name
UGT2B4, UGT2B28
Definition
UDP glucuronosyltransferase 2 family, polypeptide B4
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Bile secretion
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    461285 (UGT2B4)
   00053 Ascorbate and aldarate metabolism
    461285 (UGT2B4)
   00500 Starch and sucrose metabolism
    461285 (UGT2B4)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    461285 (UGT2B4)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    461285 (UGT2B4)
   00860 Porphyrin and chlorophyll metabolism
    461285 (UGT2B4)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    461285 (UGT2B4)
   00982 Drug metabolism - cytochrome P450
    461285 (UGT2B4)
   00983 Drug metabolism - other enzymes
    461285 (UGT2B4)
 Organismal Systems
  Digestive system
   04976 Bile secretion
    461285 (UGT2B4)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    461285 (UGT2B4)
Enzymes [BR:ptr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     461285 (UGT2B4)
Glycosyltransferases [BR:ptr01003]
 Others
  Hydrophobic molecule
   461285 (UGT2B4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 528 aa AA seqDB search
MSMKWTSALLLIQLSCYFSSGSCGKVLVWPTEFSHWMNMKTILDELVQRGHEVTVLASSA
SISFDPSSPSTLKFEVYPVSLTKTEFEDIIKQLVKRWAELPKDTFWSYFSQVQEIMWTFS
DILRKFCKDIVSNKKLMKKLQESRFDVVLADAVFPFGELLAELLKIPFVYSLRFSPGYAI
EKHSGGLLFPPSYVPVVMSELSDQMTFIERVKNMIYVLYFEFWFQIFDMKKWDQFYSEVL
GRPTTLSETMAKADIWLIRNYWDFQFPHPLLPNVEFVGGLHCKPAKPLPKEMEEFVQSSG
ENGVVVFSLGSMVSNTSEERANVIASALAKIPQKVLWRFDGNKPDTLGLNTRLYKWIPQN
DLLGHPKTRAFITHGGANGIYEAIYHGIPMVGVPLFADQPDNIAHMKAKGAAVSLDLHTM
SSTDLLNALKTVINDPLYKENAMKLSRIHHDQLVKPLDRAVFWIEFVMRHKGAKHLRVAA
HDLTWFQYHSLDVIGFLLACVATVIFIITKCLFCVWKFARTAKKGKRD
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgaaatggacttcagctcttctgctgatacagctgagctgttactttagctct
gggagttgtggaaaggtgctggtgtggcccacagaattcagccactggatgaatatgaag
acaatcctggatgaacttgtccagagaggtcatgaggtgactgtattggcatcttcagct
tccatttcttttgatcccagcagcccatctactcttaaatttgaagtttatcctgtatct
ttaactaaaactgagtttgaggatattatcaagcagctggttaagagatgggcagaactt
ccaaaagacacattttggtcatatttttcacaagtacaggaaatcatgtggacatttagt
gacatacttagaaagttctgtaaggatatagtttcaaataagaaacttatgaagaaacta
caggagtcaagatttgatgttgttcttgcagatgctgttttcccctttggtgagctgctg
gccgagttacttaaaataccctttgtctacagcctccgcttctctcctggctacgcaatt
gaaaagcatagtggaggacttctgttccctccttcctatgtgcctgttgttatgtcagaa
ctaagtgaccaaatgactttcatagagagggtaaaaaatatgatctatgtgctttatttt
gaattttggttccaaatatttgacatgaagaagtgggatcagttctacagtgaagttcta
ggaagacccactacgttatctgagacaatggcaaaagctgacatatggcttattcgaaac
tactgggattttcaatttcctcacccactcttaccaaatgttgagttcgttggaggactc
cactgcaaacctgccaaacccctaccgaaggaaatggaagagtttgtccagagctctgga
gaaaatggtgttgtggtgttttctctggggtcgatggtcagtaacacgtcagaagaaagg
gccaatgtaattgcatcagcccttgccaagatcccacaaaaggttctgtggagatttgat
gggaataaaccagatactttaggactcaatactcggctgtacaagtggataccccagaat
gatcttcttggtcacccaaaaaccagagcttttataactcatggtggagccaatggcatc
tatgaggcgatctaccatggaatccctatggtgggcgttccattgtttgcagatcaacct
gataacattgcacacatgaaggccaagggagcagctgttagtttggacttacacacaatg
tcgagtacagacttactcaatgcactgaagacagtaattaatgatcctttatataaagag
aatgctatgaaattatcaagaattcatcatgatcaactagtgaagccccttgatcgagca
gtcttctggattgaatttgtcatgcgccataaaggagccaagcaccttcgggttgcagcc
cacgacctcacctggttccagtaccactctttggatgtgattgggttcctgctggcctgt
gtggcaactgtgatattcatcatcacaaaatgtctgttttgtgtctggaagtttgctaga
acagcaaagaaggggaaaagagattaa

DBGET integrated database retrieval system