KEGG   Pan troglodytes (chimpanzee): 461289Help
Entry
461289            CDS       T01005                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B15 isoform X1
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00040  Pentose and glucuronate interconversions
ptr00053  Ascorbate and aldarate metabolism
ptr00140  Steroid hormone biosynthesis
ptr00830  Retinol metabolism
ptr00860  Porphyrin and chlorophyll metabolism
ptr00980  Metabolism of xenobiotics by cytochrome P450
ptr00982  Drug metabolism - cytochrome P450
ptr00983  Drug metabolism - other enzymes
ptr01100  Metabolic pathways
ptr05204  Chemical carcinogenesis
Module
ptr_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    461289
   00053 Ascorbate and aldarate metabolism
    461289
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    461289
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    461289
   00860 Porphyrin and chlorophyll metabolism
    461289
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    461289
   00982 Drug metabolism - cytochrome P450
    461289
   00983 Drug metabolism - other enzymes
    461289
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    461289
Enzymes [BR:ptr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     461289
Glycosyltransferases [BR:ptr01003]
 Others
  Hydrophobic molecule
   461289
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_transf_4 Glyco_trans_4_4 Spermine_synth
Motif
Other DBs
NCBI-GeneID: 461289
NCBI-ProteinID: XP_024211907
Ensembl: ENSPTRG00000022951
Position
4
AA seq 530 aa AA seqDB search
MSLKWTSVFLLIQLSCYFSSGSCGKVLVWPTEYSHWINMKTILEELVQRGHEVTVLTSSA
STLVNASKSSAIKLEVYPTSLTKNDLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEY
YDYSNKLCKDAVLNKKLMTKLQESKFDVVLADALNPCGELLAELFNIPFLYSLRFSVGYT
FEKNGGGFLFPPSYVPVVMSELSDQMIFTERIKNMIHMLYFDFWFQIYDLKKWDQFYSEV
LGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSS
GENGIVVFSLGSMISNMSEESANMIASALSQIPQKVLWRFDSKKPNTLGSNTRLYKWLPQ
NDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRT
MSSRDLLNALKSVINDPIYKENVMKLSRIHHDQPMKPLDRAVFWIEFVMRHKGAKHLRVA
AHNLTWIQYHSLDVTAFLLACVATVIFIITKFCLFCFRKLAKTGKKKKRD
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgaaatggacgtcagtctttctgctgatacagctcagttgttactttagctct
ggaagctgtggaaaggtgctagtgtggcccacagaatacagccattggataaatatgaag
acaatcctggaagagcttgttcagaggggtcatgaggtgactgtgttgacatcttcggct
tctactcttgtcaatgccagtaaatcatctgctattaaattagaagtttatcctacatct
ttaactaaaaatgatttggaagattctcttctgaaaattcttgatagatggatatatggt
gtttcaaaaaatacattttggtcatatttttcacaattacaagaattgtgttgggaatat
tatgactacagtaacaagctctgtaaagatgcagttttgaataagaaacttatgacgaaa
ctacaagagtcaaagtttgatgtcgttctggcagatgcccttaatccctgtggtgagcta
ctggctgaactatttaacataccctttctgtacagtcttcgattctctgttggctacaca
tttgagaagaatggtggaggatttctgttccctccttcctatgtacctgttgttatgtca
gaattaagtgatcaaatgattttcacggagaggataaaaaatatgatacatatgctttat
tttgacttttggtttcaaatttatgatctgaagaagtgggaccagttttatagtgaagtt
ctaggaagacccactacattatttgagacaatggggaaagctgaaatgtggctcattcga
acctattgggattttgaatttcctcgcccattcttaccaaatgttgattttgttggagga
cttcactgtaaaccagccaaacccctgcctaaggaaatggaagagttcgtgcagagctct
ggagaaaatggtattgtggtgttttctctggggtcgatgatcagtaacatgtcagaagaa
agtgccaacatgattgcatcagccctttcccagatcccacaaaaggttctatggagattt
gatagcaagaagccaaatactttaggttccaatactcgactgtacaagtggttaccccag
aatgaccttcttggtcatcccaaaaccaaagcttttataactcatggtggaaccaatggc
atctatgaggctatctaccatgggatccctatggtgggcattcccttgtttgcagatcaa
catgataacattgctcacatgaaagccaagggagcagccctcagtgtggacatcaggacc
atgtcaagtagagatttgctcaatgcattgaagtcagtcattaatgaccctatctataaa
gagaatgtcatgaaattatcaagaattcatcatgatcaaccaatgaagcccctggatcga
gcagtcttctggattgagtttgtcatgcgccacaaaggagccaagcaccttcgagtcgca
gctcacaacctcacctggatccagtaccactctttggatgtgacagcattcctgctggcc
tgcgtggcaactgtgatatttatcatcacaaaattttgcctgttttgtttccgaaagctt
gccaaaacaggaaagaagaagaaaagagattag

DBGET integrated database retrieval system