KEGG   Pan troglodytes (chimpanzee): 461358Help
Entry
461358            CDS       T01005                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10 isoform X3
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01522  Endocrine resistance
ptr04010  MAPK signaling pathway
ptr04012  ErbB signaling pathway
ptr04014  Ras signaling pathway
ptr04024  cAMP signaling pathway
ptr04068  FoxO signaling pathway
ptr04071  Sphingolipid signaling pathway
ptr04137  Mitophagy - animal
ptr04140  Autophagy - animal
ptr04141  Protein processing in endoplasmic reticulum
ptr04210  Apoptosis
ptr04215  Apoptosis - multiple species
ptr04217  Necroptosis
ptr04310  Wnt signaling pathway
ptr04380  Osteoclast differentiation
ptr04510  Focal adhesion
ptr04530  Tight junction
ptr04620  Toll-like receptor signaling pathway
ptr04621  NOD-like receptor signaling pathway
ptr04622  RIG-I-like receptor signaling pathway
ptr04625  C-type lectin receptor signaling pathway
ptr04657  IL-17 signaling pathway
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04664  Fc epsilon RI signaling pathway
ptr04668  TNF signaling pathway
ptr04722  Neurotrophin signaling pathway
ptr04723  Retrograde endocannabinoid signaling
ptr04728  Dopaminergic synapse
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04910  Insulin signaling pathway
ptr04912  GnRH signaling pathway
ptr04914  Progesterone-mediated oocyte maturation
ptr04917  Prolactin signaling pathway
ptr04920  Adipocytokine signaling pathway
ptr04926  Relaxin signaling pathway
ptr04930  Type II diabetes mellitus
ptr04931  Insulin resistance
ptr04932  Non-alcoholic fatty liver disease (NAFLD)
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr05132  Salmonella infection
ptr05133  Pertussis
ptr05142  Chagas disease (American trypanosomiasis)
ptr05145  Toxoplasmosis
ptr05152  Tuberculosis
ptr05160  Hepatitis C
ptr05161  Hepatitis B
ptr05164  Influenza A
ptr05167  Kaposi's sarcoma-associated herpesvirus infection
ptr05168  Herpes simplex infection
ptr05169  Epstein-Barr virus infection
ptr05200  Pathways in cancer
ptr05210  Colorectal cancer
ptr05212  Pancreatic cancer
ptr05231  Choline metabolism in cancer
ptr05418  Fluid shear stress and atherosclerosis
Module
ptr_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    461358 (MAPK10)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    461358 (MAPK10)
   04010 MAPK signaling pathway
    461358 (MAPK10)
   04012 ErbB signaling pathway
    461358 (MAPK10)
   04310 Wnt signaling pathway
    461358 (MAPK10)
   04668 TNF signaling pathway
    461358 (MAPK10)
   04068 FoxO signaling pathway
    461358 (MAPK10)
   04071 Sphingolipid signaling pathway
    461358 (MAPK10)
   04024 cAMP signaling pathway
    461358 (MAPK10)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    461358 (MAPK10)
   04137 Mitophagy - animal
    461358 (MAPK10)
  Cell growth and death
   04210 Apoptosis
    461358 (MAPK10)
   04215 Apoptosis - multiple species
    461358 (MAPK10)
   04217 Necroptosis
    461358 (MAPK10)
  Cellular community - eukaryotes
   04510 Focal adhesion
    461358 (MAPK10)
   04530 Tight junction
    461358 (MAPK10)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    461358 (MAPK10)
   04621 NOD-like receptor signaling pathway
    461358 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    461358 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    461358 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    461358 (MAPK10)
   04659 Th17 cell differentiation
    461358 (MAPK10)
   04657 IL-17 signaling pathway
    461358 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    461358 (MAPK10)
  Endocrine system
   04910 Insulin signaling pathway
    461358 (MAPK10)
   04920 Adipocytokine signaling pathway
    461358 (MAPK10)
   04912 GnRH signaling pathway
    461358 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    461358 (MAPK10)
   04917 Prolactin signaling pathway
    461358 (MAPK10)
   04926 Relaxin signaling pathway
    461358 (MAPK10)
  Nervous system
   04728 Dopaminergic synapse
    461358 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    461358 (MAPK10)
   04722 Neurotrophin signaling pathway
    461358 (MAPK10)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    461358 (MAPK10)
  Development
   04380 Osteoclast differentiation
    461358 (MAPK10)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    461358 (MAPK10)
   05231 Choline metabolism in cancer
    461358 (MAPK10)
   05210 Colorectal cancer
    461358 (MAPK10)
   05212 Pancreatic cancer
    461358 (MAPK10)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    461358 (MAPK10)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    461358 (MAPK10)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    461358 (MAPK10)
   04931 Insulin resistance
    461358 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    461358 (MAPK10)
  Infectious diseases
   05132 Salmonella infection
    461358 (MAPK10)
   05133 Pertussis
    461358 (MAPK10)
   05152 Tuberculosis
    461358 (MAPK10)
   05164 Influenza A
    461358 (MAPK10)
   05161 Hepatitis B
    461358 (MAPK10)
   05160 Hepatitis C
    461358 (MAPK10)
   05168 Herpes simplex infection
    461358 (MAPK10)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    461358 (MAPK10)
   05169 Epstein-Barr virus infection
    461358 (MAPK10)
   05145 Toxoplasmosis
    461358 (MAPK10)
   05142 Chagas disease (American trypanosomiasis)
    461358 (MAPK10)
  Drug resistance
   01522 Endocrine resistance
    461358 (MAPK10)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     461358 (MAPK10)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   461358 (MAPK10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like RIO1 APH FTA2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 461358
NCBI-ProteinID: XP_001156256
Ensembl: ENSPTRG00000016244
UniProt: H2QPU2
Position
4
AA seq 426 aa AA seqDB search
MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSK
MLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEV
MNSEEKTKNGVVKGQPSPSGAAVNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAG
PLGCCR
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaagcaaagttgacaaccagttctacagtgtggaagtgggagactcaaccttc
acagttctcaagcgctaccagaatctaaagcctattggctctggggctcagggcatagtt
tgtgcggcgtatgatgctgtccttgacagaaatgtggccattaagaagctcagcagaccc
tttcagaaccaaacacatgccaagagagcgtaccgggagctggtcctcatgaagtgtgtg
aaccataaaaacattattagtttattaaatgtcttcacaccccagaaaacgctggaggag
ttccaagatgtttacttagtaatggaactgatggatgccaacttatgtcaagtgattcag
atggaattagaccatgagcgaatgtcttacctgctgtaccaaatgttgtgtggcattaag
cacctccattctgctggaattattcacagggatttaaaaccaagtaacattgtagtcaag
tctgattgcacattgaaaatcctggactttggactggccaggacagcaggcacaagcttc
atgatgactccatatgtggtgacacgttattacagagcccctgaggtcatcctggggatg
ggctacaaggagaacgtggatatatggtctgtgggatgcattatgggagaaatggttcgc
cacaaaatcctctttccaggaagggactatattgaccagtggaataaggtaattgaacaa
ctaggaacaccatgtccagaattcatgaagaaattgcaacccacagtaagaaactatgtg
gagaatcggcccaagtatgcgggactcaccttccccaaactcttcccagattccctcttc
ccagcggactccgagcacaataaactcaaagccagccaagccagggacttgttgtcaaag
atgctagtgattgacccagcaaaaagaatatcagtggacgacgccttacagcatccctac
atcaacgtctggtatgacccagccgaagtggaggcgcctccacctcagatatatgacaag
cagttggatgaaagagaacacacaatcgaagaatggaaagaacttatctacaaggaagta
atgaattcagaagaaaagactaaaaatggtgtagtaaaaggacagccttctccttcaggt
gcagcagtgaacagcagtgagagtctccctccatcctcgtctgtcaatgacatctcctcc
atgtccaccgaccagaccctggcatctgacactgacagcagcctggaagcctcggcagga
cccctgggttgttgcaggtga

DBGET integrated database retrieval system