KEGG   Pan troglodytes (chimpanzee): 461396Help
Entry
461396            CDS       T01005                                 

Gene name
ADH1B
Definition
alcohol dehydrogenase 1B (class I), beta polypeptide (EC:1.1.1.1)
Orthology
K13951  
alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ptr00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:ptr00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:ptr00350]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:ptr00830]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:ptr00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:ptr00982]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:ptr05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 375 aa AA seqDB search
MSTAGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICRTDDHVVSGNLVT
PLPAILGHEAAGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRVCKNPESNYCLKNDLGNP
RGTLQDGTRRFTCRGKPIHHFLGTSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTG
YGSAVNVAKVTPGSTCAVFGLGGVGLSAVMGCKAAGAARIIAVDINKDKFAKAKELGATE
CINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPASQ
NLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHVLPFEKINEGF
DLLHSGKSIRTVLTF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagcaggaaaagtaatcaaatgcaaagcagctgtgctgtgggaggtaaagaaa
cccttttccattgaggatgtggaggttgcacctcctaaggcttatgaagttcgcattaag
atggtggctgtaggaatctgtcgcacagatgaccacgtggttagtggcaacctggtgacc
cctcttcctgcgattttaggccatgaggcagccggcatcgtggagagtgttggagaaggg
gtgactacagtcaaaccaggtgataaagtcatcccgctctttactcctcagtgtggaaaa
tgcagagtttgtaaaaacccggagagcaactactgcttgaaaaatgatctaggcaatcct
cgggggaccctgcaggatggcaccaggaggttcacctgcagggggaagcccattcaccac
ttccttggcaccagcaccttctcccagtacacggtggtggatgagaatgcagtggccaaa
attgatgcagcctcgcccctggagaaagtctgccttattggctgtggattctcgactggt
tatgggtctgcagttaacgttgccaaggtcaccccaggctctacctgtgctgtgtttggc
ctgggaggggtcggcctatctgctgttatgggctgtaaagcagctggggcagccagaatc
attgcggtggacatcaacaaggacaaatttgcaaaggccaaagagctgggtgccactgaa
tgcatcaaccctcaagactacaagaaacccatccaggaggtgctaaaggaaatgactgat
ggaggtgtggatttttcgtttgaagtcatcggtcggcttgacaccatgatggcttccctg
ttatgttgtcatgaggcatgtggcacaagcgtcatcgtaggggtacctcctgcttcccag
aacctctcaataaaccctatgctgctactgactggacgcacctggaagggggctgtttat
ggtggctttaagagtaaagaaggtatcccaaaacttgtggctgattttatggctaagaag
ttttcactggatgcgttaataacccatgttttaccttttgaaaaaataaatgaaggattt
gacctgcttcactctgggaaaagtatccgtaccgtcctgacgttttga

DBGET integrated database retrieval system