KEGG   Pan troglodytes (chimpanzee): 461396Help
Entry
461396            CDS       T01005                                 

Gene name
ADH1B
Definition
alcohol dehydrogenase 1B (class I), beta polypeptide (EC:1.1.1.1)
Orthology
K13951  
alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    461396 (ADH1B)
  Lipid metabolism
   00071 Fatty acid degradation
    461396 (ADH1B)
  Amino acid metabolism
   00350 Tyrosine metabolism
    461396 (ADH1B)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    461396 (ADH1B)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    461396 (ADH1B)
   00982 Drug metabolism - cytochrome P450
    461396 (ADH1B)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    461396 (ADH1B)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     461396 (ADH1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 375 aa AA seqDB search
MSTAGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICRTDDHVVSGNLVT
PLPAILGHEAAGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRVCKNPESNYCLKNDLGNP
RGTLQDGTRRFTCRGKPIHHFLGTSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTG
YGSAVNVAKVTPGSTCAVFGLGGVGLSAVMGCKAAGAARIIAVDINKDKFAKAKELGATE
CINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPASQ
NLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHVLPFEKINEGF
DLLHSGKSIRTVLTF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagcaggaaaagtaatcaaatgcaaagcagctgtgctgtgggaggtaaagaaa
cccttttccattgaggatgtggaggttgcacctcctaaggcttatgaagttcgcattaag
atggtggctgtaggaatctgtcgcacagatgaccacgtggttagtggcaacctggtgacc
cctcttcctgcgattttaggccatgaggcagccggcatcgtggagagtgttggagaaggg
gtgactacagtcaaaccaggtgataaagtcatcccgctctttactcctcagtgtggaaaa
tgcagagtttgtaaaaacccggagagcaactactgcttgaaaaatgatctaggcaatcct
cgggggaccctgcaggatggcaccaggaggttcacctgcagggggaagcccattcaccac
ttccttggcaccagcaccttctcccagtacacggtggtggatgagaatgcagtggccaaa
attgatgcagcctcgcccctggagaaagtctgccttattggctgtggattctcgactggt
tatgggtctgcagttaacgttgccaaggtcaccccaggctctacctgtgctgtgtttggc
ctgggaggggtcggcctatctgctgttatgggctgtaaagcagctggggcagccagaatc
attgcggtggacatcaacaaggacaaatttgcaaaggccaaagagctgggtgccactgaa
tgcatcaaccctcaagactacaagaaacccatccaggaggtgctaaaggaaatgactgat
ggaggtgtggatttttcgtttgaagtcatcggtcggcttgacaccatgatggcttccctg
ttatgttgtcatgaggcatgtggcacaagcgtcatcgtaggggtacctcctgcttcccag
aacctctcaataaaccctatgctgctactgactggacgcacctggaagggggctgtttat
ggtggctttaagagtaaagaaggtatcccaaaacttgtggctgattttatggctaagaag
ttttcactggatgcgttaataacccatgttttaccttttgaaaaaataaatgaaggattt
gacctgcttcactctgggaaaagtatccgtaccgtcctgacgttttga

DBGET integrated database retrieval system