KEGG   Pan troglodytes (chimpanzee): 461771Help
Entry
461771            CDS       T01005                                 

Gene name
RASGRF2
Definition
Ras protein-specific guanine nucleotide-releasing factor 2
Orthology
K12326  
Ras-specific guanine nucleotide-releasing factor 2
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
MAPK signaling pathway
Ras signaling pathway
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:ptr04014]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:ptr04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 1237 aa AA seqDB search
MQKSVRYNEGHALYLAFLARKEGTKRGFLSKKTAEASRWHEKWFALYQNVLFYFEGEQSC
RPAGMYLLEGCSCERTPAPPRAGAGPGGVRDALDKQYYFTVLFGHEGQKPLELRCEEEQD
GKEWMEAIHQASYADILIEREVLMQKYIHLVQIVETEKIAANQLRHQLEDQDTEIERLKS
EIIALNKTKERMRPYQSNQEDEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAES
MRKRNQIVFTMVEAESEYVHQLYILVNGFLRPLRMAASSKKPPISHDDVSSIFLNSETIM
FLHEIFHQGLKARIANWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFD
KLLKQYEANPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLE
ELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGSLIQVPSVERGKLSKV
RLGSLSLKKEGERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIDCTLIEEPDASDDDS
KGSGQVFGHLDFKIVVEPPDAAAFTVVLLAPSRQEKAAWMSDISQCVDNIRCNGLMTIVF
EENSKVTVPHMIKSDARLHKDDTDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSID
FLNTFLHTYRIFTTAAVVLGKLSDIYKRPFTSIPVRSLELFFATSQNNRGEHLVDGKSPR
LCRKFSSPPPLAVSRTSSPVRARKLSLTSPLNSKIGALDLTTSSSPTTTTQSPAASPPPH
TGQIPLDLSRGLSSPEQSPGTVEENVDNPRVDLCNKLKRSIQKAVLESAPADRAGVESSP
AADTTELSPCRSPSTPRHLRYRQPGGQTADNAHCSVSPASAFAIATAAAGHGSPPGFNNT
ERTCDKEFIIRRTATNRVLNVLRHWVSKHAQDFELNNELKMNVLNLLEEVLRDPDLLPQE
RKATANILRALSQDDQDDIHLKLEDIIQMTDCMKAECFESLSAMELAEQITLLDHVIFRS
IPYEEFLGQGWMKLDKNERTPYIMKTSQHFNDMSNLVASQIMNYADVSSRANAIEKWVAV
ADICRCLHNYNGVLEITSALNRSAIYRLKKTWAKVSKQTKALMDKLQKTVSSEGRFKNLR
ETLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQTSY
RIDHQPKVTQYLLDKDLIIDEDTLYELSLKIEPRLPA
NT seq 3714 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagagcgtgcgctacaacgaggggcacgccctgtacctggcctttctggcgcgc
aaggagggcaccaagcgcggcttcctgagtaagaagacggccgaggcgagccgctggcac
gagaagtggttcgccctctaccagaatgtgctcttctacttcgagggcgagcagagctgc
cgcccggcgggcatgtacctcctggagggctgcagctgcgaacgaacgcccgcgccaccc
agggccggcgccgggccgggaggcgtccgagacgcgctggacaagcagtattactttact
gttctttttggccatgaaggtcagaagccactggagctgcgctgtgaggaggagcaggat
ggtaaagagtggatggaggccattcaccaagccagttatgcagacattttgattgagagg
gaagtattaatgcagaagtacattcatctagttcagatcgtagagacagaaaaaattgca
gctaaccaactccgacatcaacttgaagatcaagacacagaaatcgaaaggcttaaatca
gagattattgctcttaataaaaccaaagaacgaatgcgaccttaccaaagcaaccaagaa
gatgaagatccagacatcaagaagattaaaaaggttcagagtttcatgcgaggatggttg
tgcagaaggaaatggaagaccatcgtgcaggattacatttgttctcctcatgctgaaagt
atgaggaagagaaaccagattgtgttcaccatggtggaggcagagtcagagtacgttcac
cagctctacatcctggtcaacggctttctccggcccctgcgtatggccgccagctccaag
aagccccccatcagccacgacgacgtcagcagtatttttctcaacagtgaaacaatcatg
tttcttcatgaaatatttcatcaaggactaaaggcaaggatagcgaactggcccactttg
attttagctgatctgtttgatattttgctccccatgctgaacatttatcaagaatttgtg
cgtaatcaccagtacagcctgcaagttctcgccaattgtaagcaaaacagagattttgac
aaactcttaaaacagtatgaagccaatccagcctgtgaggggaggatgctggagacattc
ttgacctatcccatgtttcagatccccagatatatcatcacactccatgagctccttgct
cacacaccccatgagcatgtggaaaggaaaagcctggagtttgccaaatcaaagctagag
gaactgtccagagtaatgcacgatgaagtcagcgacactgaaaacataaggaaaaacctt
gccatcgaaagaatgatcgtggagggctgtgacatcttgctggacaccagccaaacgttc
atccgccaaggttctcttattcaagtaccttccgttgagagggggaaacttagtaaagtt
cgcctgggttcgttgtctttgaaaaaggaaggagagagacaatgcttcttatttacaaaa
cactttttaatatgtacaagaagttcaggagggaagcttcatctgctcaagacaggtggg
gttctgtctctaatagactgcacgttgattgaggagccagatgcaagcgatgatgactct
aaaggttctgggcaagtgtttgggcacctggattttaaaatagtggtggagcctcccgac
gctgccgccttcactgttgtcttgttagcaccctcacgccaggagaaagctgcctggatg
agtgacatcagtcagtgtgtggacaatatacgatgtaatggtttaatgactatagtgttt
gaagagaattccaaagtcactgtgccacatatgattaagtctgatgcccgtcttcataaa
gacgacactgacatttgcttcagtaaaacactcaactcctgcaaagtgccccagatccgt
tatgccagcgtggagcgcctcttggaacgactgacagacttgcggtttcttagtattgat
ttcctcaacacctttctgcacacctatcgtattttcactactgccgctgtggtgctgggg
aaactctccgacatatacaagaggcctttcacctccatccctgtcaggtcattggaattg
ttttttgctaccagccagaacaacagaggtgaacatttggtggatggcaaatccccacgt
ctgtgtcgcaaattctcttccccgccaccactggctgtgtccagaacatcttccccagtg
agggccagaaagctgtctttgacttctcccttgaactcaaagataggagcattggacctg
acaacttccagcagtcccaccaccaccacccagagtcccgctgcgtctccaccaccacac
actggtcagataccactggatctcagcagaggcctctcttctccagagcaaagcccggga
acggtagaagagaatgtcgataacccacgcgtggatctgtgtaacaagctaaaacgaagt
attcaaaaagcagtcctagagtctgcaccagcggaccgagcaggagtggaaagctcccct
gcagcggacaccacagaactttcaccttgcagatccccctcaactcctcggcacctccgc
tatcgccagcctggaggacagacagcggacaatgcccactgctctgtttcaccggcttct
gcttttgcaatagccacagctgcagcaggacatgggagtccaccaggctttaacaacacc
gagagaacatgtgataaagagtttattatacggagaacggctaccaatcgagttctgaac
gtcctccgtcactgggtctcaaagcacgcacaggatttcgaactcaacaatgaactaaag
atgaatgtcctaaatttgctagaagaagttttgcgagacccagaccttcttccccaagaa
aggaaagccaccgcgaatatcctcagggccctttcacaagatgaccaagatgacatccac
ctaaaattagaggatataattcaaatgactgactgcatgaaggccgaatgctttgagtcc
ttgtcggccatggagctggcagaacagatcaccctcctggaccacgtcattttcagaagc
attccctacgaggagtttcttgggcaggggtggatgaagctggataaaaacgaaagaact
ccttacattatgaaaaccagccaacacttcaatgacatgagtaacctggtggcctcccag
ataatgaactatgctgatgtcagctcccgtgccaacgccatcgagaaatgggtggcagtg
gcggacatctgccgatgcctgcacaactacaacggcgtgctggagatcacctcggcctta
aacagaagtgccatctacaggctgaagaaaacctgggccaaggtctctaagcagacaaaa
gctctaatggacaaacttcaaaagactgtttcctctgaaggaagatttaaaaatcttaga
gaaacccttaaaaattgtaaccctcctgcagttccttatcttgggatgtacttgacagac
ctggcatttattgaagaaggaacaccaaactttactgaggaaggccttgtcaatttctcc
aaaatgagaatgatatcacacatcatcagagagatacgccagttccagcagacttcctac
agaatagatcatcagccaaaggtcacacagtacttgcttgacaaagaccttatcatagat
gaagatacgctatatgagctgtcactaaaaattgaacctcgactccctgcttga

DBGET integrated database retrieval system