KEGG   Pan troglodytes (chimpanzee): 461771Help
Entry
461771            CDS       T01005                                 

Gene name
RASGRF2
Definition
(RefSeq) Ras protein-specific guanine nucleotide-releasing factor 2
  KO
K12326  
Ras-specific guanine nucleotide-releasing factor 2
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
MAPK signaling pathway
Ras signaling pathway
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    461771 (RASGRF2)
   04010 MAPK signaling pathway
    461771 (RASGRF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 1165 aa AA seqDB search
MQKSVRYNEGHALYLAFLARKEGTKRGFLSKKTAEASRWHEKWFALYQNVLFYFEGEQSC
RPAGMYLLEGCSCERTPAPPRAGAGPGGVRDALDKQYYFTVLFGHEGQKPLELRCEEEQD
GKEWMEAIHQASYADILIEREVLMQKYIHLVQIVETEKIAANQLRHQLEDQDTEIERLKS
EIIALNKTKERMRPYQSNQEDEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAES
MRKRNQIVFTMVEAESEYVHQLYILVNGFLRPLRMAASSKKPPISHDDVSSIFLNSETIM
FLHEIFHQGLKARIANWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFD
KLLKQYEANPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLE
ELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGSLIQVPSVERGKLSKV
RLGSLSLKKEGERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIDCTLIEEPDASDDDS
KGSGQVFGHLDFKIVVEPPDAAAFTVVLLAPSRQEKAAWMSDISQCVDNIRCNGLMTIVF
EENSKVTVPHMIKSDARLHKDDTDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSID
FLNTFLHTYRIFTTAAVVLGKLSDIYKRPFTSIPVRSLELFFATSQNNRGEHLVDGKSPR
LCRKFSSPPPLAVSRTSSPVRARKLSLTSPLNSKIGALDLTTSSSPTTTTQSPAASPPPH
TGQIPLDLSRGLSSPEQSPGTVEENVDNPRVDLCNKLKRSIQKGFNNTERTCDKEFIIRR
TATNRVLNVLRHWVSKHAQDFELNNELKMNVLNLLEEVLRDPDLLPQERKATANILRALS
QDDQDDIHLKLEDIIQMTDCMKAECFESLSAMELAEQITLLDHVIFRSIPYEEFLGQGWM
KLDKNERTPYIMKTSQHFNDMSNLVASQIMNYADVSSRANAIEKWVAVADICRCLHNYNG
VLEITSALNRSAIYRLKKTWAKVSKQTKALMDKLQKTVSSEGRFKNLRETLKNCNPPAVP
YLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQTSYRIDHQPKVTQYL
LDKDLIIDEDTLYELSLKIEPRLPA
NT seq 3498 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagagcgtgcgctacaacgaggggcacgccctgtacctggcctttctggcgcgc
aaggagggcaccaagcgcggcttcctgagtaagaagacggccgaggcgagccgctggcac
gagaagtggttcgccctctaccagaatgtgctcttctacttcgagggcgagcagagctgc
cgcccggcgggcatgtacctcctggagggctgcagctgcgaacgaacgcccgcgccaccc
agggccggcgccgggccgggaggcgtccgagacgcgctggacaagcagtattactttact
gttctttttggccatgaaggtcagaagccactggagctgcgctgtgaggaggagcaggat
ggtaaagagtggatggaggccattcaccaagccagttatgcagacattttgattgagagg
gaagtattaatgcagaagtacattcatctagttcagatcgtagagacagaaaaaattgca
gctaaccaactccgacatcaacttgaagatcaagacacagaaatcgaaaggcttaaatca
gagattattgctcttaataaaaccaaagaacgaatgcgaccttaccaaagcaaccaagaa
gatgaagatccagacatcaagaagattaaaaaggttcagagtttcatgcgaggatggttg
tgcagaaggaaatggaagaccatcgtgcaggattacatttgttctcctcatgctgaaagt
atgaggaagagaaaccagattgtgttcaccatggtggaggcagagtcagagtacgttcac
cagctctacatcctggtcaacggctttctccggcccctgcgtatggccgccagctccaag
aagccccccatcagccacgacgacgtcagcagtatttttctcaacagtgaaacaatcatg
tttcttcatgaaatatttcatcaaggactaaaggcaaggatagcgaactggcccactttg
attttagctgatctgtttgatattttgctccccatgctgaacatttatcaagaatttgtg
cgtaatcaccagtacagcctgcaagttctcgccaattgtaagcaaaacagagattttgac
aaactcttaaaacagtatgaagccaatccagcctgtgaggggaggatgctggagacattc
ttgacctatcccatgtttcagatccccagatatatcatcacactccatgagctccttgct
cacacaccccatgagcatgtggaaaggaaaagcctggagtttgccaaatcaaagctagag
gaactgtccagagtaatgcacgatgaagtcagcgacactgaaaacataaggaaaaacctt
gccatcgaaagaatgatcgtggagggctgtgacatcttgctggacaccagccaaacgttc
atccgccaaggttctcttattcaagtaccttccgttgagagggggaaacttagtaaagtt
cgcctgggttcgttgtctttgaaaaaggaaggagagagacaatgcttcttatttacaaaa
cactttttaatatgtacaagaagttcaggagggaagcttcatctgctcaagacaggtggg
gttctgtctctaatagactgcacgttgattgaggagccagatgcaagcgatgatgactct
aaaggttctgggcaagtgtttgggcacctggattttaaaatagtggtggagcctcccgac
gctgccgccttcactgttgtcttgttagcaccctcacgccaggagaaagctgcctggatg
agtgacatcagtcagtgtgtggacaatatacgatgtaatggtttaatgactatagtgttt
gaagagaattccaaagtcactgtgccacatatgattaagtctgatgcccgtcttcataaa
gacgacactgacatttgcttcagtaaaacactcaactcctgcaaagtgccccagatccgt
tatgccagcgtggagcgcctcttggaacgactgacagacttgcggtttcttagtattgat
ttcctcaacacctttctgcacacctatcgtattttcactactgccgctgtggtgctgggg
aaactctccgacatatacaagaggcctttcacctccatccctgtcaggtcattggaattg
ttttttgctaccagccagaacaacagaggtgaacatttggtggatggcaaatccccacgt
ctgtgtcgcaaattctcttccccgccaccactggctgtgtccagaacatcttccccagtg
agggccagaaagctgtctttgacttctcccttgaactcaaagataggagcattggacctg
acaacttccagcagtcccaccaccaccacccagagtcccgctgcgtctccaccaccacac
actggtcagataccactggatctcagcagaggcctctcttctccagagcaaagcccggga
acggtagaagagaatgtcgataacccacgcgtggatctgtgtaacaagctaaaacgaagt
attcaaaaaggctttaacaacaccgagagaacatgtgataaagagtttattatacggaga
acggctaccaatcgagttctgaacgtcctccgtcactgggtctcaaagcacgcacaggat
ttcgaactcaacaatgaactaaagatgaatgtcctaaatttgctagaagaagttttgcga
gacccagaccttcttccccaagaaaggaaagccaccgcgaatatcctcagggccctttca
caagatgaccaagatgacatccacctaaaattagaggatataattcaaatgactgactgc
atgaaggccgaatgctttgagtccttgtcggccatggagctggcagaacagatcaccctc
ctggaccacgtcattttcagaagcattccctacgaggagtttcttgggcaggggtggatg
aagctggataaaaacgaaagaactccttacattatgaaaaccagccaacacttcaatgac
atgagtaacctggtggcctcccagataatgaactatgctgatgtcagctcccgtgccaac
gccatcgagaaatgggtggcagtggcggacatctgccgatgcctgcacaactacaacggc
gtgctggagatcacctcggccttaaacagaagtgccatctacaggctgaagaaaacctgg
gccaaggtctctaagcagacaaaagctctaatggacaaacttcaaaagactgtttcctct
gaaggaagatttaaaaatcttagagaaacccttaaaaattgtaaccctcctgcagttcct
tatcttgggatgtacttgacagacctggcatttattgaagaaggaacaccaaactttact
gaggaaggccttgtcaatttctccaaaatgagaatgatatcacacatcatcagagagata
cgccagttccagcagacttcctacagaatagatcatcagccaaaggtcacacagtacttg
cttgacaaagaccttatcatagatgaagatacgctatatgagctgtcactaaaaattgaa
cctcgactccctgcttga

DBGET integrated database retrieval system