KEGG   Pan troglodytes (chimpanzee): 462258Help
Entry
462258            CDS       T01005                                 

Gene name
KCNMB1
Definition
(RefSeq) calcium-activated potassium channel subunit beta-1 isoform X1
  KO
K04937  potassium large conductance calcium-activated channel subfamily M beta member 1
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04022  cGMP-PKG signaling pathway
ptr04270  Vascular smooth muscle contraction
ptr04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    462258 (KCNMB1)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    462258 (KCNMB1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    462258 (KCNMB1)
Ion channels [BR:ptr04040]
 Voltage-gated cation channels
  K+ channel, KCNM, KCa1.x
   462258 (KCNMB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CaKB RE_LlaMI UL41A
Motif
Other DBs
NCBI-GeneID: 462258
NCBI-ProteinID: XP_016809670
Ensembl: ENSPTRG00000017518
UniProt: H2QRZ7
Position
5
AA seq 191 aa AA seqDB search
MVKKLVMAQKRGETRALCLGVTMVVCAVITYYILVTTVLPLYQKSVWTQESKCHLIETNI
RDQEELKGKKVPQYPCLWVNVSAAGRWAVLYHTEDTRDQNQQCSYIPGSLDNYQTARADV
EKVRAKFQEQQVFYCFSAPRGNETSVLFQRLYGPQALLFSLFWPTFLLTGGLLIIAMVKS
NQYLSILAAQK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagaagctggtgatggcccagaagcggggagaaacacgagccctttgcctgggt
gtaaccatggtggtgtgtgccgtcatcacctactacatcctggtcacgactgtgctgccc
ctctaccagaaaagcgtgtggacccaggaatccaagtgccacctgattgagaccaacatc
agggaccaggaggagctgaagggcaagaaggtgccccagtacccatgcctgtgggtcaac
gtgtcagctgccggcaggtgggctgtgctgtaccacacggaggacactcgggaccagaac
cagcagtgctcctacatcccaggcagcctggacaattaccagacggcccgggccgacgtg
gagaaggtcagagccaaattccaagagcagcaggtcttctactgcttctccgcacctcgg
gggaacgaaaccagcgtcctattccagcgcctctacgggccccaggccctccttttctcc
ctcttctggcccaccttcctgctgaccggtggcctcctcattatcgccatggtgaagagc
aaccagtacctgtccatcctggcggcccagaagtag

DBGET integrated database retrieval system