KEGG   Pan troglodytes (chimpanzee): 462501Help
Entry
462501            CDS       T01005                                 

Gene name
HIST1H2BK
Definition
histone cluster 1, H2bk
Orthology
K11252  
histone H2B
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    462501 (HIST1H2BK)
  Immune diseases
   05322 Systemic lupus erythematosus
    462501 (HIST1H2BK)
  Substance dependence
   05034 Alcoholism
    462501 (HIST1H2BK)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   462501 (HIST1H2BK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSAK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgccggagccagcgaagtccgctcccgcgcccaagaagggctcgaagaaagccgtgact
aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactccgta
tacgtgtacaaggtgctgaagcaggtccaccccgacaccggcatctcctctaaggccatg
ggaatcatgaactccttcgtcaacgacatcttcgaacgcatcgcgggtgaggcttcccgc
ctggcgcattacaacaagcgctcgaccatcacctccagggagatccagacggccgtgcgc
ctgctgctgcccggggagttggccaagcacgccgtgtccgagggcaccaaggccgtcacc
aaatacaccagcgctaagtaa

DBGET integrated database retrieval system