KEGG   Pan troglodytes (chimpanzee): 462503Help
Entry
462503            CDS       T01005                                 

Gene name
POM121L2
Definition
POM121 transmembrane nucleoporin-like 2
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    462503 (POM121L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 1035 aa AA seqDB search
MGSFLSKLELSPSSPAQVRTDLPERPTKRRPPQHLHQVHRVQFVHRAHPAPRYRPVRRRP
NLDPANPTTWLANEAWRRFPMKKSQNSPLGPLPSDWWESYLKRTIWSLRHPRPIWSPVTI
RITPLDQRVPPSTSPEDVIALAGLPPSEELADPCSKETVLRALRECRKGKGRLEEPLFPE
SLDSKRRSPETRPSAFKPLMKNGTLTSFVPRPGPLKRSLHSWGSDHSLTKRPNCSSMSSL
ASIYRGGTLSSKRNAISSSYSSSRNFSDPWKRSVLSVSFETPEWPIKKEKSCHRPYSPVP
LVSDFESLGASESSGQQNQKIPQLPSSPENLVSEIPPPQLGYAVSDENLTLEKKAELQVS
NNAGEDTTEVNTDPFPETWLAIQPSLSLALPSSETDLTQGANPQLENLRKMQKSLGPLAS
PQSTGEATSVAHSPLKTPSLLTPPGCSQSELLPGTSPDSKPTATFILLTPTSPTLPVTDT
TWPPSTSQADRSPMPPDPPAPPTIQSTLLGMVSSPTSHLSASAPPDATSAHLMLKPILGP
LHNSEIGSSSYSRISVTAAASSISSLSTTQGTLTPTFKPIFGSIDPLKTMPMIAPFSSKQ
TPPPFTHASTHHFHGLVKATSVVMSTTLASTSKDSVFKPPLDFGVVNVTSAVGNTYSVPS
TCDTFLVGTAQAFRADFTPATGFIFPPHHHPTIPTVHTVTMFTQVLSSVVQISPRSSTAN
FRGMGSPLPASALVSTNWLASTPSISNLTPAITSPLGSSSRPPFPLSQGANPQPAFGATN
GQKQGPSQPALMPSVSSSFLFGSSAVALPTPMPTPAQPAFISTTQSALGCLTPSASTSQT
PASTWSGIGSIPAGFPISQASTTGFRIVIQTHQSGAFGSVFGSRAPQPFTFGGFVTPMDC
DESGIRMTGPDMSPTSGAFSIGALPSGTTSTMIPFGKGWSQNTEGLPSHRTAFSLGRGSI
SARKTMAPIAQNTPVPGQAKAGSSVGFGMPFPPAQGSVGRGPFRSSASSFSIGAKSKTPK
NREKGHSRRHHAYKK
NT seq 3108 nt NT seq  +upstreamnt  +downstreamnt
atgggcagtttcctgagcaaactggaactttcgccctcgtccccagcccaggtgcgcacc
gacttgcccgagaggcccacgaaacgccggccacctcagcaccttcaccaagttcatcgg
gttcagttcgtccaccgcgcccaccctgccccacggtatagacctgtgaggaggcggcca
aacctggatcctgccaatccaaccacgtggctggccaacgaggcttggaggcgctttccc
atgaagaagtcccagaattcccccctggggcctctcccttcagactggtgggaaagttac
ttaaagcggactatttggtctcttcgacatcccaggccaatttggagcccagtgaccatc
aggatcactcctcttgaccagagagtgcccccttccacttctcctgaagatgtaattgcc
cttgcaggactcccaccctctgaggagctcgcagatccatgttcaaaggagacagtgttg
agggccctcagagagtgcagaaaagggaaagggaggttggaagaaccactattccctgag
agtctggacagtaagagaaggagtccagagaccagaccatcggcatttaagcccctgatg
aaaaatggaaccctcacttcttttgtgcccaggcctgggccgctgaagagaagtctccac
tcctggggctcagatcacagcttgactaagaggcccaattgctcctccatgagctccttg
gccagcatatacagaggtggcaccctcagctccaaaaggaatgctatttccagctcttac
agctcttccagaaatttctcagacccttggaagagaagtgttctcagtgtgtcattcgag
acaccagagtggccaataaaaaaggaaaaaagttgtcatcggccttactctccagtccca
ctggtatcagattttgagtccctaggagcatctgaaagttctgggcagcaaaaccagaag
attccacagctgccgtctagccctgagaacctggtgtcagagatcccacctccccagctt
ggttatgcagtctctgatgagaacttgactttggagaagaaagctgagctacaggtaagc
aacaacgcaggagaagatacaactgaggtcaacacagaccctttccctgagacttggctt
gctattcagccttccttatctcttgctctgccttcttcagaaacagatctaacccaggga
gcaaatcctcagttggaaaacttaagaaaaatgcagaagtctctaggtccactggcctct
ccacagtccacaggagaggcaaccagtgtggcccattctcctttgaagacacccagccta
ctgaccccacctgggtgctcacagtcagagctccttccaggcacctctccagactcaaag
cccacagctactttcatcctgctgacccccacctctcccacattaccagttactgacacc
acctggccgccttcaacctctcaggctgacaggtctcccatgcccccagacccacctgca
ccacccaccatccaaagtactttgcttggaatggtgagtagcccaacatcccatctttct
gcatctgcacctcctgatgcaacttctgctcacctcatgttaaaaccgattttggggccc
ctgcacaacagcgagattggaagctcctcatattccagaatttcagtcacagctgcagca
tcttcaatctcttccctttccacaactcagggtacattaactcctaccttcaagcctatc
tttggcagcatagatccacttaaaactatgcccatgatagctcctttctcctccaagcag
acccctcctccatttactcatgcttctacccatcatttccatggcctggtcaaggccacc
tctgtggtcatgtccaccaccctagccagcacatctaaagactctgtttttaagccacct
ttggattttggtgtagtgaatgtcaccagtgccgtaggcaacacttattctgtcccttcc
acttgcgacactttcctggttgggactgctcaggccttcagggccgacttcaccccagcc
acaggattcattttcccaccacaccaccatcctacaattcctactgtgcatacagtcacc
atgtttacccaggtcctttccagtgttgtacagatatcccctagaagcagcactgctaat
ttcaggggtatgggcagccctctgcctgcctctgccctagtatccacaaactggcttgca
tcaacccccagcatctccaacctgactccagcaatcacaagtcccttgggatcaagctca
aggccacctttcccactatcccaaggagctaatccccagcctgcatttggtgccacaaat
ggacagaaacaagggccttcccagccagcccttatgccaagtgtcagtagttcttttctt
tttgggagctcagcagtggcattgccaacccccatgccaactccagctcagccagccttc
attagtaccacacagtcagccttggggtgtttgacaccctcagcctccacctctcaaacc
cctgccagcacctggtcaggcattggcagcattccagcaggttttcccattagtcaagct
agtacaactgggtttagaattgtaattcagacccaccaaagtggggcttttggctcagtg
tttggcagcagagccccacaacctttcacttttgggggattcgtgacccctatggactgt
gatgagtctgggatcagaatgactggtccagacatgagccccacctctggagctttcagc
attggagcattgcctagtgggaccactagcaccatgatcccctttggaaaaggctggagc
cagaacactgaaggcctgcccagccaccgcacagctttttccttggggagaggcagcatt
tctgcaagaaagactatggcccccattgctcaaaacaccccagtccctggacaagctaag
gcaggcagcagtgttggctttgggatgccttttccacctgcccagggctctgttgggaga
ggaccttttagatcatcagcgtcttcattttccattggcgcaaaatcaaaaacgccaaag
aatcgggagaaaggacattcccgaaggcatcatgcctacaagaagtag

DBGET integrated database retrieval system