KEGG   Pan troglodytes (chimpanzee): 462545Help
Entry
462545            CDS       T01005                                 

Gene name
MRPS18B
Definition
mitochondrial ribosomal protein S18B
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    462545 (MRPS18B)
Ribosome [BR:ptr03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    462545 (MRPS18B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 258 aa AA seqDB search
MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLE
SEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNV
KLLEQFVCAHTGIIFHAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTS
HGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQGHLREESGPPPESMPKMPP
RTPAEASSTGQTGPQSAL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtctgtattaaacaccgtgctgaggcggcttcctatgctatctctcttccga
ggttctcacagagttcaggttcccctccagactctttgcaccaaagctccctctgaggaa
gattctttgtcctcagttcccatttctccttataaggatgagccctggaaatatctggaa
tcagaagaataccaggagcgatatggttctcgccccgtctgggctgactaccgccgcaac
cacaagggtggtgtacccccacagcggactcggaagacatgtattcgtcggaataaagtt
gttgggaatccctgccccatctgtcgagatcacaagttgcatgttgactttaggaacgtg
aagctcttggagcaatttgtctgcgcccacacgggtatcatcttccatgctccatacaca
ggagtctgtgtgaagcagcacaagcggttgacccaggccatccagaaagccagggatcat
ggtctcctcatttaccacatcccccaggttgaaccacgggaccttgacttcagtacctct
catggggctgtgagtgctactccgccagcccccaccctggtctcaggtgacccctggtac
ccatggtacaactggaaacagccaccggagagagaactgtctcgccttcgccggctttac
cagggtcatctccgagaagagagtggccccccacctgagtcaatgcccaagatgccccct
agaacaccagcggaagcctcctccactgggcagacaggccctcagagtgctctgtag

DBGET integrated database retrieval system