KEGG   Pan troglodytes (chimpanzee): 462549Help
Entry
462549            CDS       T01005                                 

Gene name
GTF2H4, BTF2_p52
Definition
general transcription factor IIH, polypeptide 4, 52kDa
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Basal transcription factors
Nucleotide excision repair
Viral carcinogenesis
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:ptr03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:ptr03420]
Human Diseases; Cancers; Viral carcinogenesis [PATH:ptr05203]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 462 aa AA seqDB search
MESTPSRGLNRVHLQCRNLQEFLGGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRML
FLEQPLPQAAVALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRI
ALLGGGKAWSDDTSQLGPDKHARDVPSLDKYAEERWEVVLHFMVGSPSAAVSQDLAQLLS
QAGLMKSTEPGEPPCITSAGFQFLLLDTPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQL
SFSTLGKDYSVEGMSDSLLNFLQHLREFGLVFQRKRKSRRYYPTRLAINLSSGVSGAGGT
VHQPGFIVVETNYRLYAYTESELQIALIALFSEMLYRFPNMVVAQVTRESVQQAIASGIT
AQQIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFEL
LLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaccccttcaaggggactgaaccgagtacacctacaatgcaggaatctgcag
gaattcttagggggcctgagccctggggtattggaccgattgtatgggcaccctgccaca
tgtctggctgtcttcagggagctcccatccttggctaagaactgggtgatgcggatgctc
tttctggagcagcctttgccacaggctgctgtagctctgtgggtaaagaaggaattcagc
aaggctcaggaggaaagtacagggctgctgagcggcctccggatctggcacacccagctg
ctcccaggcgggctccagggcctcatcctcaaccccattttccgccagaacctccgcatt
gcccttctgggtggggggaaggcctggtctgatgacacaagtcagctgggaccagacaag
catgcccgggacgttccctcccttgacaagtacgccgaggagcgatgggaggtggtcttg
cacttcatggtgggctcccccagtgcagctgtcagccaggacttggctcagctcctcagc
caggctgggctcatgaagagtactgaacctggagagccaccctgcattacttctgctggc
ttccagttcctgttgctggacaccccggctcagctctggtactttatgttgcagtatttg
cagacagcccagagccggggcatggacctggtagagattctctccttcctcttccagctc
agcttctctactctgggcaaggattactctgtggaaggtatgagtgattctctgttgaac
ttcctgcaacatctgcgtgagtttgggcttgttttccagaggaagaggaaatctcggcgt
tactaccccacacgcctggccatcaatctctcatcaggtgtctctggagctgggggcact
gtgcatcagccaggtttcattgtcgtggaaaccaattaccgactgtatgcctacacggag
tcggagctgcagattgccctcattgccctcttctctgagatgctctatcggttccccaac
atggtggtggcgcaggtgacccgggagagtgtgcagcaggcaatcgccagtggcatcaca
gcccagcagataatccatttcctaaggacaagagcccacccagtgatgctcaaacagaca
cctgtgctgccccccaccatcaccgaccagatccggctctgggagctggaaagggacaga
ctccggttcactgagggtgtcctgtataaccagttcctgtcgcaagtggactttgagttg
ctgctggcccacgcgcgggagctgggcgtgctcgtgttcgagaactcggccaagcggctc
atggtggtgaccccggccgggcacagcgacgtcaagcgcttttggaagcggcagaaacac
agctcctga

DBGET integrated database retrieval system