KEGG   Pan troglodytes (chimpanzee): 462580Help
Entry
462580            CDS       T01005                                 

Gene name
PPT2
Definition
palmitoyl-protein thioesterase 2
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    462580 (PPT2)
  Lipid metabolism
   00062 Fatty acid elongation
    462580 (PPT2)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    462580 (PPT2)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     462580 (PPT2)
Lipid biosynthesis proteins [BR:ptr01004]
 Fatty acid synthase
  Component type
   462580 (PPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 308 aa AA seqDB search
MKSCGSMLGLWGQRLPAAWVLLLLPFLPLLLLAAPGPHRASYKPVIVVHGLFDSSYSFRH
LLEYINETHPGTVVTVLDLFDGRESLRPLWEQVQGFREAVVPIMAKAPQGLHLICYSQGG
LVCRALLSVMDDHNVDSFISLSSPQMGQYGDTDYLKWLFPTSMRSNLYRICYSPWGQEFS
ICNYWHDPHHDDLYLNASSFLALINGERDHPNATVWRKNFLRVGHLVLIGGPDDGVITPW
QSSFFGFYDANETVLEMEEQLVYLRDSFGLKTLLARGAIVRCPMAGISHTAWHSNRTLYE
TCIEPWLS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaagagttgcgggagcatgctggggctctgggggcagcggctccccgcggcgtgggtc
ctgcttctgttgcctttcctgccgctgctgctgcttgcagcccccgggccccaccgcgcg
tcctacaagccggtcatcgtggtgcatgggctcttcgacagctcgtacagcttccgccac
ctgctggaatacatcaatgagacacaccccgggactgtggtgacagtgctcgatctcttc
gatgggagagagagcttgcgacccctgtgggaacaggtgcaagggttccgagaggctgtg
gtccccatcatggcaaaggcccctcaagggttgcatctcatctgctactcgcaggggggc
cttgtgtgccgggctctgctttctgtcatggatgatcacaatgtggattctttcatctcc
ctctcctctccacagatgggacagtatggagacacggactacttgaagtggctgttcccc
acctccatgcggtctaacctctatcggatctgctatagcccctggggccaggaattctcc
atctgcaactactggcatgatccccaccatgatgacttgtacctcaatgccagcagcttc
ctggccctgatcaatggggaaagagaccatcccaatgccacagtatggcggaagaacttc
cttcgtgtgggccacctggtgctgattgggggccctgatgatggtgttattactccctgg
cagtccagcttctttggtttctatgatgcaaatgagaccgtcctggagatggaggagcaa
ctggtttatctgcgggattcttttgggttgaagactctattggcccggggggccatagtg
aggtgtccaatggccgggatctcccacacagcctggcactccaaccgtaccctttatgag
acctgcattgaaccttggctctcctga

DBGET integrated database retrieval system