KEGG   Pan troglodytes (chimpanzee): 462580Help
Entry
462580            CDS       T01005                                 

Gene name
PPT2
Definition
palmitoyl-protein thioesterase 2
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ptr01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:ptr00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:ptr04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 308 aa AA seqDB search
MKSCGSMLGLWGQRLPAAWVLLLLPFLPLLLLAAPGPHRASYKPVIVVHGLFDSSYSFRH
LLEYINETHPGTVVTVLDLFDGRESLRPLWEQVQGFREAVVPIMAKAPQGLHLICYSQGG
LVCRALLSVMDDHNVDSFISLSSPQMGQYGDTDYLKWLFPTSMRSNLYRICYSPWGQEFS
ICNYWHDPHHDDLYLNASSFLALINGERDHPNATVWRKNFLRVGHLVLIGGPDDGVITPW
QSSFFGFYDANETVLEMEEQLVYLRDSFGLKTLLARGAIVRCPMAGISHTAWHSNRTLYE
TCIEPWLS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaagagttgcgggagcatgctggggctctgggggcagcggctccccgcggcgtgggtc
ctgcttctgttgcctttcctgccgctgctgctgcttgcagcccccgggccccaccgcgcg
tcctacaagccggtcatcgtggtgcatgggctcttcgacagctcgtacagcttccgccac
ctgctggaatacatcaatgagacacaccccgggactgtggtgacagtgctcgatctcttc
gatgggagagagagcttgcgacccctgtgggaacaggtgcaagggttccgagaggctgtg
gtccccatcatggcaaaggcccctcaagggttgcatctcatctgctactcgcaggggggc
cttgtgtgccgggctctgctttctgtcatggatgatcacaatgtggattctttcatctcc
ctctcctctccacagatgggacagtatggagacacggactacttgaagtggctgttcccc
acctccatgcggtctaacctctatcggatctgctatagcccctggggccaggaattctcc
atctgcaactactggcatgatccccaccatgatgacttgtacctcaatgccagcagcttc
ctggccctgatcaatggggaaagagaccatcccaatgccacagtatggcggaagaacttc
cttcgtgtgggccacctggtgctgattgggggccctgatgatggtgttattactccctgg
cagtccagcttctttggtttctatgatgcaaatgagaccgtcctggagatggaggagcaa
ctggtttatctgcgggattcttttgggttgaagactctattggcccggggggccatagtg
aggtgtccaatggccgggatctcccacacagcctggcactccaaccgtaccctttatgag
acctgcattgaaccttggctctcctga

DBGET integrated database retrieval system