KEGG   Pan troglodytes (chimpanzee): 462844Help
Entry
462844            CDS       T01005                                 

Gene name
TTK
Definition
(RefSeq) dual specificity protein kinase TTK isoform X1
  KO
K08866  serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    462844 (TTK)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     462844 (TTK)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: Other
  TTK family
   462844 (TTK)
Chromosome [BR:ptr03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     462844 (TTK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH FTA2 Kdo RIO1 Mad3_BUB1_I Mad3_BUB1_I_2 Tubulin
Motif
Other DBs
NCBI-GeneID: 462844
NCBI-ProteinID: XP_009449862
Ensembl: ENSPTRG00000018371
UniProt: K7DTY6
Position
6
AA seq 857 aa AA seqDB search
MESEDLSGRELTIDSIMNKVRDIKNKFKNEDLTDELSLNKISADTTDNSGTVNQIMMMAN
NPEDWLNLLLKLEKNSVPLSDALLNKLIGRYSQAIEALPPDKYGQNESFARIQVRFAELK
AIQEPDDARDYFQMARANCKKFAFVHISFAQFELSQGNVKKSKQLLQKAVERGAVPLEML
EIALRNLNLQKKQLLSEEEKKNLSASTVLTAQESFSGSLGHLQNRNNSCDSRGQTTKARF
LYGENLPPQDAEIGYRNSLRQTNKTKQSCPFGRVPVNLLNSPDCDVKTDDSVVPCFMKRQ
TSRSECRDLVVPGSKPSGNDSCELRNLKSVQNSHFKEPLVSDEKSSELIITDSITLKNKT
ESSLLAKLEETKEYQEPEVPESNQKQWQSKRKSECINQNPAASSNHWQIPELARKVNTEQ
KHTTFEQPVFSVSKQSPPISTSKWFDPKSFCKTPSSNTLDDYMSCFRTPVVKNDFPPACQ
LSTPYGQPACFQQQQQQILATPLQNLQVLASSSANECISVKGRIYSILKQIGSGGSSKVF
QVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQHIYM
VMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGML
KLIDFGIANQMQPDTTSIVKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSL
GCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRI
SIPELLAHPYVQIQTHPGNQMAKGTTEEMKYVLGQLVGLNSPNSILKAAKTLYEHYSGGE
SHNSSSSKTFEKKRGKK
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atggagtccgaggatttaagtggcagagaattgacaattgattccataatgaacaaagtg
agagacattaaaaataagtttaaaaatgaagaccttactgatgaactaagcttgaataaa
atttctgctgatactacagataactcgggaactgttaaccaaattatgatgatggcaaac
aacccagaggactggttgaatttgttgctcaaactagagaaaaacagtgttccgctaagt
gatgctcttttaaataaattgattggtcgttacagtcaagcaattgaagcgcttccccca
gataaatatggccaaaatgagagttttgctagaattcaagtgagatttgctgaattaaaa
gctattcaagagccagatgatgcacgtgactactttcaaatggccagagcaaactgcaag
aaatttgcttttgttcatatatcttttgcacaatttgaactgtcacaaggtaatgtcaaa
aaaagtaaacaacttcttcaaaaagctgtagaacgtggagcagtaccactagaaatgctg
gaaattgccctgcggaatttaaacctccaaaaaaagcagctgctttcagaggaggaaaag
aagaatttatcagcatctacggtattaactgcccaagaatcattttccggttcacttggg
catttacagaataggaacaacagttgtgattccagaggacagactactaaagccaggttt
ttatatggagagaacctgccaccacaagatgcagaaataggttatcggaattcattgaga
caaactaacaaaactaaacagtcatgcccatttggaagagtcccagttaaccttctaaat
agcccagattgtgatgtgaagacagatgattcagttgtaccttgttttatgaaaagacaa
acctctagatcagaatgccgagatttggttgtgcccggatctaaaccaagtggaaatgat
tcctgtgaattaagaaatttaaagtctgttcaaaatagtcatttcaaggaacctctggtg
tcagatgaaaagagttctgaacttattattactgattcaataaccctgaagaataaaacg
gaatcaagtcttctagctaaattagaagaaactaaagagtatcaagaaccagaggttcca
gagagtaaccagaaacagtggcaatctaagagaaagtcagagtgtattaaccagaatcct
gctgcatcttcaaatcactggcagattccggagttagcccgaaaagttaatacagagcag
aaacataccacttttgagcaacctgtcttttcagtttcaaaacagtcaccaccaatatca
acatctaaatggtttgacccaaaatctttttgtaagacaccaagcagcaataccttggat
gattacatgagctgttttagaactccagttgtaaagaatgactttccacctgcttgtcag
ttgtcaacaccttatggccaacctgcctgtttccagcagcaacagcagcaaatacttgcc
actccacttcaaaatttacaggttttagcatcttcttcagcaaatgaatgcatttcggtt
aaaggaagaatttattccatattaaagcagataggaagtggaggttcaagcaaggtattt
caggtgttgaatgaaaagaaacagatatatgctataaaatatgtgaacttagaagaagca
gataaccaaactcttgatagttaccggaacgaaatagcttatttgaataaactacaacaa
cacagtgataagatcatccgactttatgattatgaaatcacggaccagcacatctacatg
gtaatggagtgtggaaatattgatcttaatagttggcttaaaaagaaaaaatccattgat
ccatgggaacgcaagagttactggaaaaatatgttagaggcagttcacacaatccatcaa
catggcattgttcacagtgatcttaaaccagctaactttctgatagttgatggaatgcta
aagctaattgattttgggattgcaaaccaaatgcaaccagatacaacaagtattgttaaa
gattctcaggttggcacagttaattatatgccaccagaagcaatcaaagatatgtcttcc
tccagagagaacgggaaatctaagtcaaagataagccccaaaagtgatgtttggtcctta
ggatgtattttgtactatatgacttacgggaagacaccatttcagcagataattaatcag
atttctaaattgcatgccataattgatcctaatcatgaaattgaatttcctgatattcca
gagaaagatcttcaagatgtgttaaagtgttgtttaaaaagggacccaaaacagaggata
tccattcctgagctcctggctcatccatatgttcaaattcaaactcatccaggtaaccaa
atggccaagggaaccactgaagaaatgaaatatgttctgggccaacttgttggtctgaat
tctcctaactccattttgaaagctgctaaaactttatatgaacactatagtggtggtgaa
agtcataattcttcatcatccaagacttttgaaaaaaaaaggggaaaaaaatga

DBGET integrated database retrieval system