KEGG   Pan troglodytes (chimpanzee): 462950Help
Entry
462950            CDS       T01005                                 

Gene name
HDAC2
Definition
histone deacetylase 2
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Cell cycle
Notch signaling pathway
Thyroid hormone signaling pathway
Huntington's disease
Alcoholism
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    462950 (HDAC2)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    462950 (HDAC2)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    462950 (HDAC2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    462950 (HDAC2)
   05202 Transcriptional misregulation in cancers
    462950 (HDAC2)
   05203 Viral carcinogenesis
    462950 (HDAC2)
   05220 Chronic myeloid leukemia
    462950 (HDAC2)
  Neurodegenerative diseases
   05016 Huntington's disease
    462950 (HDAC2)
  Substance dependence
   05034 Alcoholism
    462950 (HDAC2)
  Infectious diseases
   05169 Epstein-Barr virus infection
    462950 (HDAC2)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     462950 (HDAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 581 aa AA seqDB search
MRPPPRGLRRWFGGPLLASWCRCHLRFRAFGTSAGWYRIFPAPPPLLPPACPSPRDYRPH
VSLSPFLSRPSRGGSSSSSSRRRSPEAAVAGEPMAYSQGGGKKKVCYYYDGDIGNYYYGQ
GHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSE
YSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSE
ASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFP
GTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSL
SGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPN
ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE
DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARI
EEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccacctccccgcggcctccggaggtggtttggtggccccctgctcgcgagttgg
tgccgctgccacctccgattccgagctttcggcacctctgccgggtggtaccgaatcttc
ccggcgccccctcctctcctcccaccggcctgcccttccccgcgggactatcgcccccac
gtttccctcagcccttttctctcccggccgagccgcggcggcagcagcagcagcagcagc
aggaggaggagcccggaggcggcggtggccggggagcccatggcgtacagtcaaggaggc
ggcaaaaaaaaagtctgctactactacgacggtgatattggaaattattattatggacag
ggtcatcccatgaagcctcatagaatccgcatgacccataacttgctgttaaattatggc
ttatacagaaaaatggaaatatataggccccataaagccactgccgaagaaatgacaaaa
tatcacagtgatgagtatatcaaatttctacggtcaataagaccagataacatgtctgag
tatagtaagcagatgcagagatttaatgttggagaagattgtccagtgtttgatggactc
tttgagttttgtcagctctcaactggcggttcagttgctggagctgtgaagttaaaccga
caacagactgatatggctgttaattgggctggaggattacatcatgctaagaaatcagaa
gcatcaggattttgttacgttaatgatattgtgcttgccatccttgaattactaaagtat
catcagagagtcttatatattgatatagatattcatcatggtgatggtgttgaagaagct
ttttatacaacagatcgtgtaatgacggtatcattccataaatatggggaatactttcct
ggcacaggagacttgagggatattggtgctggaaaaggcaaatactatgctgtcaatttt
ccaatgagagatggtatagatgatgagtcatatgggcagatatttaagcctattatctca
aaggtgatggagatgtatcaacctagtgctgtggtattacagtgtggtgcagactcatta
tctggtgatagactgggttgtttcaatctaacagtcaaaggtcatgctaaatgtgtagaa
gttgtaaaaacttttaacttaccattactgatgcttggaggaggtggctacacaatccgt
aatgttgctcgatgttggacatatgagactgcagttgcccttgattgtgagattcccaat
gagttgccatataatgattactttgagtattttggaccagacttcaaactgcatattagt
ccttcaaacatgacaaaccagaacactccagaatatatggaaaagataaaacagcgttta
tttgaaaatttgcgcatgttacctcatgcacctggtgtccagatgcaagctattccagaa
gatgctgttcatgaagacagtggagatgaagatggagaagatccagacaagagaatttct
attcgagcatcagacaagcggatagcttgtgatgaagaattctcagattctgaggatgaa
ggagaaggaggtcgaagaaatgtggctgatcataagaaaggagcaaagaaagctagaatt
gaagaagataagaaagaaacagaggacaaaaaaacagacgttaaggaagaagataaatcc
aaggacaacagtggtgaaaaaacagataccaaaggaaccaaatcagaacagctcagcaac
ccctga

DBGET integrated database retrieval system