KEGG   Pan troglodytes (chimpanzee): 463138Help
Entry
463138            CDS       T01005                                 

Gene name
THBS2
Definition
(RefSeq) thrombospondin 2
  KO
K04659  
thrombospondin 2/3/4/5
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    463138 (THBS2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    463138 (THBS2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    463138 (THBS2)
  Cellular community - eukaryotes
   04510 Focal adhesion
    463138 (THBS2)
 Human Diseases
  Infectious diseases
   05165 Human papillomavirus infection
    463138 (THBS2)
   05144 Malaria
    463138 (THBS2)
Membrane trafficking [BR:ptr04131]
 Endocytosis
  Phagocytosis
   Opsonins
    463138 (THBS2)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   463138 (THBS2)
  Exosomal proteins of colorectal cancer cells
   463138 (THBS2)
  Exosomal proteins of bladder cancer cells
   463138 (THBS2)
Cell adhesion molecules and their ligands [BR:ptr04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     463138 (THBS2)
  Beta3 integrins
   alpha IIb  beta 3
    ITGB3; integrin beta 3 [KO:K06493]
     463138 (THBS2)
   VNR
     463138 (THBS2)
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   463138 (THBS2)
Glycosaminoglycan binding proteins [BR:ptr00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   463138 (THBS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
6
AA seq 1631 aa AA seqDB search
MVWRLVLLALWVWPSTQAGHQDKDTTFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRF
DYIPPVNADDLSKITKIMRQKEGFFLTAQLKQDGKSRGTLLALEGPGLSQRQFEIVSNGP
ADTLDLTYWIDGTRHVVSLEDVGLADSQWKNVTVQVAGETYSLHVGCDLIDSFALDEPFY
EHLQAEKSRMYVAKGSARESHFRGLLQNVHLVFENSLEDILSKKGCQQGQGGRCVVKNAF
YILAGMDFYCDMVCVCVCVCVCMHACKNLSKNIWVTTTIVFETGVRSPLFSYTLQVLVIV
HVLESNLVKRLSHYYFTTENTGRSLEKCKLAGRFYYQAFPQRTEAQGCAGPGALPVHAQY
SAGRHGTGGLSGHRLRESNQGEAQDRTGWKNVSLLTVRREEQRPPWSWPPAAGPVLRNAH
GPLLVCLKLRINAISENTETLRLACPHSPPEYVGPSSREAGPKVCDARVEELGNMVQELS
RGSTSSLNQLSENSREVVRYQRGAGFTALGSSALAHLSQTADRVMAAPTTSTWRRTRVRR
VQVTELTPVRQHQDMFSRIIPAVVLPTARSDESTFDPSYLSLRIWLTKHSFSAYNDQFDL
LGWVNEQPQKKLEFTRAESVLNRNETGLSQRFALSTGPDDWEKRGPTPTGTRVSPARHSL
RVSHLLRLQARVWMEGPKQVLLVTSQDRPLCWVPEPHVTEHWVHSAHGDQPSSPSTAARG
SKHSGIRPCLTDVPQNRTGTGQLANVCTVITCCHNTVTDLRVFSDSQLGLHRGLLWAHLR
DHWAQLPRLRSIRTGLPTPAFPGLPHSFLAMRAVFWGLTLQVHEVQLSTTHVSFSAKNRP
SCQQADMFLVLGGPPMSSQRNWLSFDWKINSSHERSHTSGLLSELGPTYSVVTCGPRRSV
SVFSLMALISAEGKHRRAGRPRPTCSSLSLSQLTFSTPGLALSFPRLAFPAVDGRWSPWS
PWSACTVTCAGGIRERTRVCNSPEPQYGGKACVGDVQERQMCNKRSCPVDGCLSNPCFPG
AQCSSFPDGSWSCGSCPVGFLGNGTHCEDLDECALVPDICFSTSKVPRCVNTQPGFHCLP
CPPRYRGNQPVGVGLDAAKTEKQVCEPENPCKDKTHNCHKHAECIYLGHFSDPMYKCECQ
TGYAGDGLICGEDSDLDGWPNLNLVCATNATYHCIKDNCPHLPNSGQEDFDKDGIGDACD
DDDDNDGVTDEKDNCQLLFNPRQADYDKDEVGDRCDNCPYVHNPAQIDTDNNGEGDACSV
DIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPLVHNPDQTDVDNDLVGDQCDNN
EDIDDDGHQNNQDNCPYISNANQADHDRDGQGDACDPDDDNDGVPDDRDNCRLVFNPDQE
DLDGDGRGDICKDDFDNDNIPDIDDVCPENNAISETDFRNFQMVPLDPKGTTQIDPNWVI
RHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDRDDDYAGFVFGYQSSSRFYVVM
WKQVTQTYWEDQPTRAYGYSGVSLKVVNSTTGTGEHLRNALWHTGNTPGQVRTLWHDPRN
IGWKDYTAYRWHLTHRPKTGYIRVLVHEGKQVMADSGPIYDQTYAGGRLGLFVFSQEMVY
FSDLKYECRDI
NT seq 4896 nt NT seq  +upstreamnt  +downstreamnt
atggtctggaggctggtcctgctggctctgtgggtgtggcccagcacgcaagctggtcac
caggacaaagacacgaccttcgaccttttcagtatcagcaacatcaaccgcaagaccatt
ggcgccaagcagttccgcgggcccgaccccggcgtgccggcttaccgcttcgtgcgcttt
gactacatcccaccggtgaacgcagatgacctcagcaagatcaccaagatcatgcggcag
aaggagggcttcttcctcacggcccagctcaagcaggacggcaagtccaggggcacgctg
ttggctctggagggccccggtctctcccagaggcagttcgagatcgtctccaatggcccc
gcggacacgctggatctcacctactggattgacggcacccggcacgtggtctccctggag
gacgtcggcctggctgactcgcagtggaagaacgtcaccgtgcaggtggctggcgagacc
tacagcttgcacgtgggctgcgacctcatagacagcttcgctctggacgagcccttctac
gagcacctgcaggcggaaaagagccggatgtacgtggccaaaggctctgccagagagagt
cacttcaggggtttgcttcagaacgtccacctagtgtttgaaaactctctggaagacatt
ctaagcaagaagggttgccagcaaggccagggaggtaggtgtgttgtgaaaaatgcattt
tatatactggctgggatggatttctattgtgacatggtgtgtgtgtgtgtgtgtgtatgt
gtgtgcatgcatgcttgtaaaaatttaagtaaaaatatttgggtaactaccactattgtc
tttgaaaccggggtgcgtagcccactcttcagttacactttgcaggtcctggtcattgtg
cacgtccttgagagtaaccttgtgaagaggctgagccattattattttacaactgagaat
actggcagaagcctggagaaatgcaagttagctggaaggttttactaccaggccttccct
caacgtactgaggctcagggctgtgcaggaccgggtgcgctcccggtccacgcacagtac
agtgcaggccgccacgggacagggggcctcagcggccatcgactgcgggaaagcaaccag
ggggaagctcaagacagaacggggtggaagaacgtgagcttgctgacggtgaggagggaa
gagcagcgtcctccgtggtcctggccccctgctgctggccccgtcctccgtaatgctcac
ggccctctattagtatgcctcaagctgagaatcaacgccatcagtgagaacacagagacg
ctgcgcctggcttgtccgcattcaccaccggagtacgtgggccccagctcgcgagaggca
ggcccgaaggtgtgcgacgctcgtgttgaggagctgggaaacatggtccaggagctctcg
cgcggctccacgtcatcgctgaaccagctcagcgagaactccagagaagtggtgcggtac
cagcggggcgcggggttcacagcactgggcagctccgcgctggcccatctcagccagacg
gccgatcgggtgatggctgcccccacgacatccacatggcgtagaaccagggtgcgaaga
gttcaagtaacagagctaacaccagtcaggcagcatcaagacatgttcagccgcattata
ccggctgtggtgctcccgaccgcgcgcagtgatgagagcaccttcgatccctcgtatcta
tctctgaggatctggctgacgaaacatagcttctcggcctacaatgaccaatttgacttg
cttggatgggttaacgagcaaccgcagaagaaactagagttcactcgtgctgagtctgtc
ctgaaccggaatgaaacggggctatctcagaggtttgcgctgagcacaggtcccgatgac
tgggagaaacgcggccccacccccacaggcacgcgggtgtcacctgcccgacactcactg
cgggtgtcacacttgctcagactgcaagcccgtgtctggatggagggccccaagcaggtg
ttgctggtgacgtcacaggaccggcctctctgctgggtcccagagccacacgtcacagag
cactgggtccactctgcccacggagaccagccctcctcaccgtccaccgctgccagagga
agcaaacacagtggcatcaggccctgcctcacagacgtgccacagaacagaacgggcaca
gggcagctggcgaatgtgtgtacagtgatcacttgctgccataacacagtcacagatcta
cgtgtgttctctgactctcagctggggctccatcggggcctgctctgggctcacctgcgt
gaccactgggctcagcttcctcgtctgagaagcatcaggactggccttcccacccccgcg
ttcccagggcttccacactcctttctggccatgagagccgtgttctggggcctcaccttg
caggtacacgaggtgcagctgtccaccacccacgtttcattttccgcaaagaaccggcca
tcctgccagcaagctgacatgttccttgtcttaggagggccaccgatgagctcccagaga
aactggttatcattcgactggaaaatcaactcctcacacgagcgttcgcacacctcgggc
ctcctctccgagctggggcccacgtactcggtggtgacatgcggacccaggcgcagcgtc
tctgtgttctcactgatggcgttgatctcagctgagggcaagcatagacgggccggaaga
ccacgtcccacctgctcttccctctcactcagccaactcacgttctccaccccgggtctt
gctctgagcttcccccggttggctttccccgcagtcgatggccgctggagcccctggtcc
ccgtggtcggcctgcactgtcacctgtgccggtgggatccgggagcgcacccgggtctgc
aacagccctgagcctcagtacggagggaaggcctgcgtgggggatgtgcaggagcgtcag
atgtgcaacaagaggagctgccccgtggatggctgtttatccaacccctgcttcccggga
gcccagtgcagcagcttccccgatgggtcctggtcatgcggctcctgccctgtgggcttc
ttgggcaatggcacccactgtgaggacctggacgagtgtgccctggtccccgacatctgc
ttctccaccagcaaggtgcctcgctgtgtcaacactcagcccggcttccactgcctgccc
tgcccgccccgatacagagggaaccagcccgtcggggtcggcctggacgcagccaagacg
gaaaagcaagtgtgtgagcccgaaaacccatgcaaggacaagacacacaactgccacaag
cacgcggagtgcatctacctgggccacttcagcgaccccatgtacaagtgcgagtgccag
acaggctacgcgggcgacgggctcatctgcggggaggactcggacctggacggctggccc
aacctcaatctggtctgcgccaccaacgccacctaccactgcatcaaggataactgcccc
catctgccaaattctgggcaggaagactttgacaaggacgggattggcgatgcctgtgat
gatgacgatgacaatgacggtgtgaccgatgagaaggacaactgccagctcctcttcaat
ccccgccaggctgactatgacaaggatgaggttggggaccgctgtgacaactgcccttac
gtgcacaaccctgcccagatcgacacagacaacaatggagagggtgacgcctgctccgtg
gacattgatggggacgatgtcttcaatgaacgagacaattgtccctacgtctacaacact
gaccagagggacacggatggtgacggtgtgggggatcactgtgacaactgccccctggtg
cacaaccctgaccagaccgacgtggacaatgaccttgttggggaccagtgtgacaacaac
gaggacatagatgatgacggccaccagaacaaccaggacaactgcccctacatctccaac
gccaaccaggctgaccatgacagagacggccagggcgacgcctgtgaccccgatgatgac
aacgatggcgtccccgatgacagggacaactgccggcttgtgttcaacccagaccaggag
gacttggacggtgatggacggggtgatatttgtaaagatgattttgacaatgacaacatc
ccagatattgatgatgtgtgtcctgaaaacaatgccatcagtgagacagacttcaggaac
ttccagatggtccccttggatcccaaagggaccacccaaattgatcccaactgggtcatt
cgccatcaaggcaaggagctggttcagacagccaactcggaccctggcatcgctgtaggt
tttgacgagtttgggtctgtggacttcagtggcacattctacgtaaacactgaccgggac
gacgactatgcaggcttcgtctttggttaccagtcaagcagccgcttctatgtggtgatg
tggaagcaggtgacgcagacctactgggaggaccagcccacgcgggcctatggctactcc
ggcgtgtccctcaaggtggtgaactccaccacagggacgggcgagcacctgaggaacgcg
ctgtggcacacggggaacacgccggggcaggtgcgaaccttatggcacgaccccaggaac
attggctggaaggactacacggcctataggtggcacctgactcacaggcccaagaccggc
tacatcagagtcttagtgcatgaaggaaaacaggtcatggcagactcaggacctatctat
gaccaaacctacgctggcgggcggctgggtctatttgtcttctctcaagaaatggtctat
ttctcagacctcaagtacgaatgcagagatatttaa

DBGET integrated database retrieval system