KEGG   Pan troglodytes (chimpanzee): 463280Help
Entry
463280            CDS       T01005                                 

Gene name
HDAC9
Definition
histone deacetylase 9
Orthology
K11409  
histone deacetylase 9 [EC:3.5.1.98]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Alcoholism
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    463280 (HDAC9)
  Substance dependence
   05034 Alcoholism
    463280 (HDAC9)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     463280 (HDAC9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 1066 aa AA seqDB search
MHSMISSVDVKSEVPVGLEPISPLDLRTDLRMMMPVVDPVVREKQLQQELLLIQQQQQIQ
KQLLIAEFQKQHENLTRQHQAQLQEHIKELLAIKQQQELLEKEQKLEQQRQEQEVERHRR
EQQLPPLRGKDRGRERAVASTEVKQKLQEFLLSKSATKDTPTNGKNHSVSRHPKLWYTAA
HHTSLDQSSPPLSGTSPSYKYTLPGAQDAKDDFPLRKTASEPNLKVRSRLKQKVAERRSS
PLLRRKDGNVVTSFKKRMFEVTESSVSSSSPGSGPSSPNNGPTGSVTENETSVLPSTPHA
EQMVSQQRILIHEDSMNLLSLYTSPSLPNITLGLPAVPSQLNASNSLKEKQKCETQTLRQ
GVPLPGQYGGSIPASSSHPHVTLEGKPPNSSHQALLQHLLLKEQMRQQKLLVAGGVPLHP
QSPLATKERISPGIRGTHKLPRHRPLNRTQSAPLPQSTLAQLVIQQQHQQFLEKQKQYQQ
QIHMNKLLSKSIEQLKQPGSHLEEAEEELQGDQAMQEDRAPSSGNSTRSDSSACVDDTLG
QVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQPFLEPPHTRALSVRQAPLAAVGMDGL
EKHRLVSRTHSSPAASVLPHPAMDRPLQPGSATGIAYDPLMLKHQCVCGNSTTHPEHAGR
IQSIWSRLQETGLLNKCERIQGRKASLEEIQLVHSEHHSLLYGTNPLDGQKLDPRILLGD
DSRKFFSSLPCGGLGVDSDTIWNELHSSGAARMAVGCVIELASKVASGELKNGFAVVRPP
GHHAEESTAMGFCFFNSVAITAKYLRDQLNISKILIVDLDVHHGNGTQQAFYADPSILYI
SLHRYDEGNFFPGSGAPNEVGTGLGEGYNINIAWTGGLDPPMGDVEYLEAFRTIVKPVAK
EFDPDMVLVSAGFDALEGHTPPLGGYKVTAKCFGHLTKQLMTLADGRVVLALEGGHDLTA
ICDASEACVNALLGNELEPLAEDILHQSPNMNAVISLQKIIEIQSKYWKSVRMVAVPRGC
ALAGAQLQEETETVSALASLTVDVEQPFAQEDSRTAGEPMEEEPAL
NT seq 3201 nt NT seq  +upstreamnt  +downstreamnt
atgcacagtatgatcagctcagtggatgtgaagtcagaagttcctgtgggcctggagccc
atctcacctttagacctaaggacagacctcaggatgatgatgcccgtggtggaccctgtt
gtccgtgagaagcaattgcagcaggaattacttcttatccagcagcagcaacaaatccag
aagcagcttctgatagcagagtttcagaaacagcatgagaacttgacacggcagcaccag
gctcagcttcaggagcatatcaaggaacttctagccataaaacagcaacaagaactccta
gaaaaggagcagaaactggagcagcagaggcaagaacaggaagtagagaggcatcgcaga
gaacagcagcttcctcctctcagaggcaaagatagaggacgagaaagggcagtggcaagt
acagaagtaaagcagaagcttcaagagttcctactgagtaaatcagcaacgaaagacact
ccaactaatggaaaaaatcattccgtgagccgccatcccaagctctggtacacggctgcc
caccacacatcattggatcaaagctctccaccccttagtggaacatctccatcctacaag
tacacattaccaggagcacaagatgcaaaggatgatttcccccttcgaaaaactgcctct
gagcccaacttgaaggtgcggtccaggttaaaacagaaagtggcagagaggagaagcagc
cccttactcaggcggaaggatggaaatgttgtcacttcattcaagaagcgaatgtttgag
gtgacagaatcctcagtcagtagcagttctccaggctctggtcccagttcaccaaacaat
gggccaactggaagtgttactgaaaatgagacttcggttttgccctctacccctcatgct
gagcaaatggtttcacagcaacgcattctaattcatgaagattccatgaacctgctaagt
ctttatacctctccttctttgcccaacattaccttggggcttcccgcagtgccatcccag
ctcaatgcttcgaattcactcaaagaaaagcagaagtgtgagacgcagacgcttaggcaa
ggtgttcctctgcctgggcagtatggaggcagcatcccggcatcttccagccaccctcac
gttactttagagggaaagccacccaacagcagccaccaggctctcctgcagcatttatta
ttgaaagaacaaatgcgacagcaaaagcttcttgtagctggtggagttcccttacatcct
cagtctcccttggcaacaaaagagagaatttcacctggcattagaggtacccacaaattg
ccccgtcacagacccctgaaccgaacccagtctgcacctttgccgcagagcacgttggct
cagctggtcattcaacagcaacaccagcaattcttggagaagcagaagcaataccagcag
cagatccacatgaacaaactgctttcgaaatctattgaacaactgaagcaaccaggcagt
caccttgaggaagcggaggaagagcttcagggggaccaggcgatgcaggaagacagagcg
ccctctagtggcaacagcactaggagcgacagcagtgcttgtgtggatgacacactggga
caagttggggctgtgaaggtcaaggaggaaccagtggacagtgatgaagatgctcagatc
caggaaatggaatctggggagcaggctgcttttatgcaacagcccttcctggaacccccg
cacacacgtgcgctctctgtgcgccaagctccgctggctgcggttggcatggatggatta
gagaaacaccgtcttgtctccaggactcactcttcccctgctgcctctgttttacctcac
ccagcaatggaccgccccctccagcctggctctgcaactggaattgcctatgaccccttg
atgctgaaacaccagtgcgtttgtggcaattccaccacccaccctgagcatgctggacga
atacagagtatctggtcacgactgcaagaaactgggctgctaaataaatgtgagcgaatt
caaggtcgaaaagccagcctggaggaaatacagcttgttcattctgaacatcactcactg
ttgtatggcaccaaccccctggacggacagaagctggaccccaggatactcctaggtgat
gactctcgaaagtttttttcctcattaccttgtggtggacttggggtggacagtgacacc
atttggaatgagctacactcgtccggtgctgcacgcatggctgttggctgtgtcatcgag
ctggcttccaaagtggcctcaggagagctgaagaatgggtttgctgttgtgaggccccct
ggccatcacgctgaagaatccacagccatggggttctgcttttttaattcagttgcaatt
accgccaaatacttgagagaccaactaaatataagcaagatattgattgtagatctggat
gttcaccatggaaacggtacccagcaggccttttatgctgaccccagcatcctgtacatt
tcactccatcgctatgatgaagggaactttttccctggcagtggagccccaaatgaggtt
ggaacaggccttggagaagggtacaatataaatattgcctggacaggtggccttgatcct
cccatgggagatgttgagtaccttgaagcattcaggaccatcgtgaagcctgtggccaaa
gagtttgatccagacatggtcttagtatctgctggatttgatgcattggaaggccacacc
cctcctctaggagggtacaaagtgacggcaaaatgttttggtcatttgacgaagcaattg
atgacattggctgatggacgtgtggtgttggctctagaaggaggacatgatctcacagcc
atctgtgatgcatcagaagcctgtgtaaatgccctcctaggaaatgagctggagccactt
gcagaagatattctccaccaaagcccgaatatgaatgctgttatttctttacagaagatc
attgaaattcaaagcaagtattggaagtcagtaaggatggtggctgtgccaaggggctgt
gctctggctggtgctcagttgcaagaggagacagagaccgtttctgccctggcctcccta
acagtggatgtggaacagccctttgctcaggaagacagcagaactgctggtgagcctatg
gaagaggagccagccttgtga

DBGET integrated database retrieval system