KEGG   Pan troglodytes (chimpanzee): 463477Help
Entry
463477            CDS       T01005                                 

Gene name
POM121C
Definition
(RefSeq) nuclear envelope pore membrane protein POM 121C
  KO
K14316  
nuclear pore complex protein Nup121
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    463477 (POM121C)
Messenger RNA biogenesis [BR:ptr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     463477 (POM121C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 1257 aa AA seqDB search
MTWRARDDATRGAVHAGIFKSPPRRGAAMSPAAAAAGAGERRRPIASVRDGRGRGCGGPA
GAALLVLSLVGLLLYLVPAAAALAWLAVGTTAAWWGLSREPRGSRPLSSFVQKARHRRTL
FASPPAKSTANGNLLEPRTLLEGPDPAELLLMGSYLGKPGPPQPAPAPEGQDLRNRPGRR
PPARPAPRSTPPSPPTHRVHHVYPSLPTPLLRPSGRPSPRDRGTLPDRFVITPRRRYPIH
QAQYSCLGVLPTVCWNGYHKKAVLSPRNSRMVCSPVTVRIAPPDRRFSRSAIPEQIISST
LSSPSSNAPDPCAKETVLSALKEKKKKRTVEEEDQIFLDGQENKRRRHDSSGSGHSAFEP
LVASGVPASFVPKPGSLKRGLNSQSSDDHLNKRSRSSSMSSLTGAYTSGIPSSSRNAITS
SYSSTRGISQLWKRNGPSSSPFSSPASSRSQTPERPAKKIREEELCHHSSSSTPLAADKE
SQGEKAADTTPRKKQNSNSQSTPGSSGQRKRKVQLLPSRRGEQLTLPPPPQLGYSITAED
LDLEKKAALQWFNQALEDKSDAASNSVTETPPITQPSFTFTLPAAATASPPTSLLAPSTN
PLLESLKKMQTPPSLPPCPESAGAATTEAPSPPKTPSLLPPLGLSQSGPPGPLPSPSFDS
KPPTTLLGLIPAPSMVPATDTKAPPTLQAETATKPQATSAPSPAPKQSFLFGTQNTSPSS
PAAPAASSASPMFKPIFTAPPKSEKEGPTPPGPSVTATAPSSSSLPTTTSTTAPTFQPVF
SSMGPPASMPLPAPFFKQTTTPTTAPTTTAPLFSGLASATSAVAPITSASPSTDSASKPA
FGFGINSVSSSSVSTTTSTATAASQPFLFGAPQASAASFTPAMGSIFQFGKPPALPTTTT
VTTFSQSLPTAVPTATSSSAADFSGFGSTLATSAPATSSQPALTFSNMSTPTFNIPFGSN
AKSPLPSYPGANPQPAFGAAEGQPPGTAKPALTPSFGSSFTFGNSAAPAPATAPTPASAS
TIKIVPAHVPTPIQPTFGGATHSAFGLKATASAFGTPASSQPAFGGSTAVFSFGAATSSG
FGATTQTASSGSSSSVFGSTTPSPFTFGGSAAPAGSGSFGINVATPGSSATAGAFSFGAG
QSGSTATSTPFAGGLGQNSLGTTSQSTPFAFNVGSTTESKPVFGGTATPTFGQNTPAPGV
GTSGSSLSFGASSAPAQGFVGVAPFGSAAPSFSIGAGSKTPGARQRLQARRQHTRKK
NT seq 3774 nt NT seq  +upstreamnt  +downstreamnt
atgacgtggcgggcgcgcgatgacgcgacgcgtggcgcggtgcacgctgggatatttaag
tctcctccgcggcgcggagccgcgatgtctccggcggctgcggcggccggagcaggcgag
cggcgacggccgatagcgagtgtcagggacggccggggccggggctgcggcgggccggcc
ggggcggcgcttcttgtcctgtcgctggtcggcctcctactgtacctcgtgcctgctgcg
gctgcgctggcctggctggccgtggggactaccgcggcctggtggggactgagccgcgag
ccccgaggttcgcgccccttgtcctccttcgttcagaaggcgcgacatcggcgaacactg
ttcgcttcgcctccggccaagtcgacagccaacggaaacctcctagagccgcggaccctg
ctcgaaggacctgaccctgccgaactgctcctcatgggcagttacctgggcaagcccggg
ccgccgcagcccgcccccgctccggagggccaggacctgcggaataggcctggccgccgc
ccacccgcccgcccggcgccgcgctccacaccgccctccccgccgacccatcgcgttcac
cacgtttacccctctctccccactcctcttctccgaccctccgggaggccttccccacgg
gatcgtgggactttaccagatcggtttgtaataacacctcgaagacgctatccgatccat
caggcccagtattcctgtctgggggtacttcccacagtgtgctggaatggttatcacaag
aaggctgtgctgtcccctcgcaactccaggatggtgtgtagcccagtgactgtgaggatc
gcccctcctgacagaagattttcgcgttctgcgataccagagcagataatcagctcaaca
ctgtcctcaccatcaagtaatgccccagacccatgtgcaaaggagactgtactgagtgcc
ctcaaagagaagaagaagaaaaggacagtggaggaagaagaccaaatattccttgatggc
caggaaaataaaagaaggcgccatgatagcagtggcagtggacattcagcatttgagccc
ctggtggccagtggagtccccgcttcttttgtgcctaagcctgggtctctgaagagaggc
ctcaattctcagagctcagatgaccacttgaataagagatcccgaagctcttccatgagc
tccttgacaggcgcttacacaagtggcatccctagctccagccgcaatgccattaccagt
tcctacagctccactcgaggcatctcacagctctggaagagaaatggccccagttcatca
cccttctctagcccagcctcatcccgctcccagacaccggagaggccagcaaagaaaata
agagaagaggagctgtgtcatcattccagttcttcaactccattggcagcagacaaggag
tcccagggagaaaaggctgcagatacaaccccaaggaagaaacaaaactcgaattctcag
tctacacctggcagctctgggcagcgtaagcggaaagttcagctgctgccttctcggcga
ggggaacagctgaccttgcctccacctccccagcttggctattcgatcactgccgaggac
ctagacttagagaagaaggctgcattacagtggttcaaccaggccttggaggacaagagt
gatgctgcctcgaactctgtcactgagaccccacctatcactcagccttcatttaccttt
accctgcctgctgctgcaactgcctccccacccacctccctcctggccccaagcaccaac
ccactgttagagagcttgaagaagatgcagactcccccgagcctgccaccctgcccagaa
tctgctggagcagcaaccactgaggccccctcacctccaaagacacccagcctcctaccc
ccgctgggtttatcacagtcagggccgccagggccgctccccagcccctcctttgactcc
aaacccccgaccactttgctggggctgatccctgctccatccatggtaccagccactgac
accaaggcacctccaacccttcaggcagagacggctaccaaaccccaagccacatctgcc
ccgtcccccgcccccaagcaaagcttcctgtttggaacacagaacacctcaccttccagc
cctgccgcccctgctgcatcttcagcatctcccatgttcaagcccattttcacggcccca
cccaagagtgagaaggaaggccccacaccgcctggcccttcagtcacagccacagcgccc
tccagctcctccctccccactaccaccagcaccacagccccgaccttccagcctgtcttt
agcagcatggggccacctgcatctatgcccttgcctgctcccttcttcaagcagacaact
actcccaccactgctcccaccacaactgccccgctcttctctggcctggccagcgccacc
tctgctgtggctcccatcacctctgccagtccatccacagactctgcttcgaagcctgcg
tttggctttggcataaacagtgtgagcagcagcagtgtgagtaccacgaccagcaccgcc
actgctgcctcacagcctttcctcttcggggcgccccaggcctctgctgccagcttcacc
ccggccatgggctccatattccagtttggcaaacctcctgccctgcccacaaccaccaca
gtcaccaccttcagccagtccctgcccactgctgtgccaacggccaccagcagcagcgct
gccgactttagtggttttggcagcaccctcgccacctccgccccggccaccagcagccag
cccgctctgacgttcagtaacatgagcaccccaacgttcaacattccctttggctcaaac
gccaagtccccactcccatcatatccaggagccaacccccagcccgcatttggggccgct
gaggggcagccaccggggaccgccaagccagcccttacccccagctttggcagctctttc
acttttggaaactctgcagccccggccccggctactgcacccacacctgcatctgcgtcc
acgatcaagatcgtgcctgcgcacgtgcctacgcccatccagcctacctttggcggtgcc
acgcactcggcgtttgggttgaaagccacggcttcggccttcggcactcccgccagctca
cagcccgcctttggcggctccactgctgtcttctccttcggtgcagccaccagctccggc
tttggagccaccacccagactgccagcagcgggagcagcagctcggtgtttggcagcaca
acaccatcacccttcacgtttgggggttcggcagcccccgctggcagtgggagctttggg
atcaacgtggccaccccaggctccagcgccaccgccggagctttcagctttggagcagga
cagagtgggagcacagccacctccacccccttcgcagggggcttaggtcagaactccctg
ggcaccaccagccagagcacaccgtttgccttcaacgtgggcagcacaactgagagcaaa
cctgtgtttggaggcaccgccacccccacctttggtcagaacacccctgcgcctggagtg
ggcacatcgggcagcagcctctcctttggggcatcctcagcacccgcccaaggctttgtt
ggtgttgcacctttcggatcggcggccccttcattttccattggtgcaggatccaagacc
ccaggggctcgacagcgactgcaggcccgaaggcagcacacccgcaaaaagtag

DBGET integrated database retrieval system