KEGG   Pan troglodytes (chimpanzee): 463477Help
Entry
463477            CDS       T01005                                 

Gene name
POM121C, POM121
Definition
POM121 transmembrane nucleoporin C
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
RNA transport
Module
Nuclear pore complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:ptr03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 1052 aa AA seqDB search
MVCSPVTVRIAPPDRRFSRSAIPEQIISSTLSSPSSNAPDPCAKETVLSALKEKKKKRTV
EEEDQIFLDGQENKRRRHDSSGSGHSAFEPLVASGVPASFVPKPGSLKRGLNSQSSDDHL
NKRSRSSSMSSLTGAYTSGIPSSSRNAITSSYSSTRGISQLWKRNGPSSSPFSSPASSRS
QTPERPAKKIREEELCHHSSSSTPLAADKESQGEKAADTTPRKKQNSNSQSTPGSSGQRK
RKVQLLPSRRGEQLTLPPPPQLGYSITAEDLDLEKKAALQWFNQALEDKSDAASNSVTET
PPITQPSFTFTLPAAATASPPTSLLAPSTNPLLESLKKMQTPPSLPPCPESAGAATTEAP
SPPKTPSLLPPLGLSQSGPPGPLPSPSFDSKPPTTLLGLIPAPSMVPATDTKAPPTLQAE
TATKPQATSAPSPAPKQSFLFGTQNTSPSSPAAPAASSASPMFKPIFTAPPKSEKEGPTP
PGPSVTATAPSSSSLPTTTSTTAPTFQPVFSSMGPPASMPLPAPFFKQTTTPTTAPTTTA
PLFSGLASATSAVAPITSASPSTDSASKPAFGFGINSVSSSSVSTTTSTATAASQPFLFG
APQASAASFTPAMGSIFQFGKPPALPTTTTVTTFSQSLPTAVPTATSSSAADFSGFGSTL
ATSAPATSSQPALTFSNMSTPTFNIPFGSNAKSPLPSYPGANPQPAFGAAEGQPPGTAKP
ALTPSFGSSFTFGNSAAPAPATAPTPASASTIKIVPAHVPTPIQPTFGGATHSAFGLKAT
ASAFGTPASSQPAFGGSTAVFSFGAATSSGFGATTQTASSGSSSSVFGSTTPSPFTFGGS
AAPAGSGSFGINVATPGSSATAGAFSFGAGQSGSTATSTPFAGGLGQNSLGTTSQSTPFA
FNVGSTTESKPVFGGTATPTFGQNTPAPGVGTSGSSLSFGASSAPAQGFVGVAPFGNTFA
HQQEHSPRKGPNNLSKCKLLPAVRAQGPPRRGQASSFPTRKESAWSLCYVQGGVQAPAAA
LCCLFFLFGAGLGVRSGADALACEAELEKCRC
NT seq 3159 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgtagcccagtgactgtgaggatcgcccctcctgacagaagattttcgcgttct
gcgataccagagcagataatcagctcaacactgtcctcaccatcaagtaatgccccagac
ccatgtgcaaaggagactgtactgagtgccctcaaagagaagaagaagaaaaggacagtg
gaggaagaagaccaaatattccttgatggccaggaaaataaaagaaggcgccatgatagc
agtggcagtggacattcagcatttgagcccctggtggccagtggagtccccgcttctttt
gtgcctaagcctgggtctctgaagagaggcctcaattctcagagctcagatgaccacttg
aataagagatcccgaagctcttccatgagctccttgacaggcgcttacacaagtggcatc
cctagctccagccgcaatgccattaccagttcctacagctccactcgaggcatctcacag
ctctggaagagaaatggccccagttcatcacccttctctagcccagcctcatcccgctcc
cagacaccggagaggccagcaaagaaaataagagaagaggagctgtgtcatcattccagt
tcttcaactccattggcagcagacaaggagtcccagggagaaaaggctgcagatacaacc
ccaaggaagaaacaaaactcgaattctcagtctacacctggcagctctgggcagcgtaag
cggaaagttcagctgctgccttctcggcgaggggaacagctgaccttgcctccacctccc
cagcttggctattcgatcactgccgaggacctagacttagagaagaaggctgcattacag
tggttcaaccaggccttggaggacaagagtgatgctgcctcgaactctgtcactgagacc
ccacctatcactcagccttcatttacctttaccctgcctgctgctgcaactgcctcccca
cccacctccctcctggccccaagcaccaacccactgttagagagcttgaagaagatgcag
actcccccgagcctgccaccctgcccagaatctgctggagcagcaaccactgaggccccc
tcacctccaaagacacccagcctcctacccccgctgggtttatcacagtcagggccgcca
gggccgctccccagcccctcctttgactccaaacccccgaccactttgctggggctgatc
cctgctccatccatggtaccagccactgacaccaaggcacctccaacccttcaggcagag
acggctaccaaaccccaagccacatctgccccgtcccccgcccccaagcaaagcttcctg
tttggaacacagaacacctcaccttccagccctgccgcccctgctgcatcttcagcatct
cccatgttcaagcccattttcacggccccacccaagagtgagaaggaaggccccacaccg
cctggcccttcagtcacagccacagcgccctccagctcctccctccccactaccaccagc
accacagccccgaccttccagcctgtctttagcagcatggggccacctgcatctatgccc
ttgcctgctcccttcttcaagcagacaactactcccaccactgctcccaccacaactgcc
ccgctcttctctggcctggccagcgccacctctgctgtggctcccatcacctctgccagt
ccatccacagactctgcttcgaagcctgcgtttggctttggcataaacagtgtgagcagc
agcagtgtgagtaccacgaccagcaccgccactgctgcctcacagcctttcctcttcggg
gcgccccaggcctctgctgccagcttcaccccggccatgggctccatattccagtttggc
aaacctcctgccctgcccacaaccaccacagtcaccaccttcagccagtccctgcccact
gctgtgccaacggccaccagcagcagcgctgccgactttagtggttttggcagcaccctc
gccacctccgccccggccaccagcagccagcccgctctgacgttcagtaacatgagcacc
ccaacgttcaacattccctttggctcaaacgccaagtccccactcccatcatatccagga
gccaacccccagcccgcatttggggccgctgaggggcagccaccggggaccgccaagcca
gcccttacccccagctttggcagctctttcacttttggaaactctgcagccccggccccg
gctactgcacccacacctgcatctgcgtccacgatcaagatcgtgcctgcgcacgtgcct
acgcccatccagcctacctttggcggtgccacgcactcggcgtttgggttgaaagccacg
gcttcggccttcggcactcccgccagctcacagcccgcctttggcggctccactgctgtc
ttctccttcggtgcagccaccagctccggctttggagccaccacccagactgccagcagc
gggagcagcagctcggtgtttggcagcacaacaccatcacccttcacgtttgggggttcg
gcagcccccgctggcagtgggagctttgggatcaacgtggccaccccaggctccagcgcc
accgccggagctttcagctttggagcaggacagagtgggagcacagccacctccaccccc
ttcgcagggggcttaggtcagaactccctgggcaccaccagccagagcacaccgtttgcc
ttcaacgtgggcagcacaactgagagcaaacctgtgtttggaggcaccgccacccccacc
tttggtcagaacacccctgcgcctggagtgggcacatcgggcagcagcctctcctttggg
gcatcctcagcacccgcccaaggctttgttggtgttgcacctttcggcaacacttttgct
caccagcaagaacacagcccaaggaagggacccaataacctttcaaaatgcaaactgctg
cctgcggtgagggcccagggtcctccacggagaggacaggcatcttcctttcccaccagg
aaggagtcagcctggagcctctgctatgtgcaaggcggtgtgcaagcaccggctgcggct
ctttgctgtctcttctttctctttggggctgggctgggtgtgcgttctggtgctgatgct
ttggcctgtgaggctgagctagagaagtgtagatgttag

DBGET integrated database retrieval system