KEGG   Pan troglodytes (chimpanzee): 463481Help
Entry
463481            CDS       T01005                                 

Gene name
POR
Definition
(RefSeq) NADPH--cytochrome P450 reductase
  KO
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     463481 (POR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 717 aa AA seqDB search
MATPPPPRPAKAVVAPQWCGPAPCPGARREQPGCQRFMINMGDSHVDTSSTVSEAVAEEV
SLFSMTDMILFSLIVGLLTYWFLFRKKKEEVPEFTKIQTLTSSVRESSFVEKMKKTGRNI
IVFYGSQTGTAEEFANRLSKDAHRYGMRGMSADPEEYDLADLSSLPEIDNALVVFCMATY
GEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKTYEHFNAMGKYVDKRLEQLGAQRI
FELGLGDDDGNLEEDFITWREQFWPAVCEHFGVEATGEESSIRQYELVVHTDIDAAKVYM
GEMGRLKSYENQKPPFDAKNPFLAAVTTNRKLNQGTERHLMHLELDISDSKIRYESGDHV
AVYPANDSALVNQLGKILGADLDIVMSLNNLDEESNKKHPFPCPTSYRTALTYYLDITNP
PRTNVLYELAQYASEPSEQELLRKMASSSGEGKELYLSWVVEARRHILAILQDCPSLRPP
IDHLCELLPRLQARYYSIASSSKVHPNSVHICAVVVEYETKAGRINKGVATNWLRAKEPA
GENGGRALVPMFVRKSQFRLPFKATTPVIMVGPGTGVAPFIGFIQERAWLRQQGKEVGET
LLYYGCRRSDEDYLYREELAQFHRDGALTQLNVAFSREQSHKVYVQHLLKRDREHLWKLI
EGGAHIYVCGDARNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTKGRYSLDVWS
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atggccacgcccccacccccgcggccggcgaaggcggtggtagcgcctcagtggtgcggg
cctgcgccctgcccaggtgcccgcagagagcagccgggctgccagcgtttcatgatcaac
atgggggactcccacgtggacaccagctccactgtgtccgaggcggtggctgaagaagta
tctctttttagcatgacggacatgattctgttttcgctcatcgtgggtctcctaacctac
tggttcctcttcagaaagaaaaaagaagaagtccccgagttcaccaaaattcagacattg
acctcctctgtcagagagagcagctttgtggaaaagatgaagaaaacggggaggaacatc
atcgtgttctacggctcccagacggggactgcagaggagtttgccaaccgcctgtccaag
gacgcccaccgctacgggatgcgaggcatgtcagcggaccctgaggagtatgacctggcc
gacctgagcagcctgccagagatcgacaacgccctggtggttttctgcatggccacctac
ggtgagggagaccccaccgacaatgcccaggacttctacgactggctgcaggagacagac
gtggatctctctggggtcaagttcgcggtgtttggtcttgggaacaagacctacgagcac
ttcaatgccatgggcaagtacgtggacaagcggctggagcagctcggcgcccagcgcatc
tttgagctggggttgggcgacgacgatgggaacttggaggaggacttcatcacctggcga
gagcagttctggccggccgtgtgtgaacactttggggtggaagccactggcgaggagtcc
agcattcgccagtacgagcttgtggtccacaccgacatagacgcggccaaggtgtacatg
ggggagatgggccggctgaagagctacgagaaccagaagcccccctttgatgccaagaat
ccgttcctggctgcagtcaccaccaaccggaagctgaaccagggaaccgagcgccacctc
atgcacctggaattggacatctcagactccaaaatcaggtatgaatctggggaccacgtg
gctgtgtacccagccaacgactctgctctcgtcaaccagctgggcaaaatcctgggtgcc
gacctggacattgtcatgtccctgaacaacctggatgaggagtccaacaagaagcaccca
ttcccgtgccctacgtcctaccgcacggccctcacctactacctggacatcaccaacccg
ccgcgcaccaacgtgctgtacgagctggcgcagtacgcctcggagccctcggagcaggag
ctgctgcgcaagatggcctcctcctctggcgagggcaaggagctgtacctgagctgggtg
gtggaggcccggaggcacatcctggccatcctgcaggactgcccgtccctgcggcccccc
atcgaccacctgtgtgagctgctgccgcgcctgcaggcccgctactactctatcgcctca
tcctccaaggtccaccccaactctgtgcacatctgtgcggtggttgtggagtacgagacc
aaggccggccgcatcaacaagggcgtggccaccaactggctgcgggccaaggagcctgcc
ggggagaacggcggccgtgcactggtgcccatgttcgtgcgcaagtcccagttccgcctg
cccttcaaggccaccacgcctgtcatcatggtgggccccggcaccggggtggcacccttc
ataggcttcatccaggagcgggcctggctgcgacagcagggcaaggaggtgggggagacg
ctgttgtactacggctgccgccgctcggatgaggactacctgtaccgggaggagctggcg
cagttccacagggacggtgcgctcacccagctcaacgtggccttctcccgggagcagtcc
cacaaggtctacgtccagcacctgctaaagcgagaccgagagcacctgtggaagttgatc
gaaggtggtgcccacatctacgtctgtggggatgcacggaacatggccagggatgtgcag
aacaccttctacgacatcgtggctgagctcggggccatggagcacgcacaggcggtggac
tacatcaagaaactgatgaccaagggccgctactccctggacgtgtggagctag

DBGET integrated database retrieval system