KEGG   Pan troglodytes (chimpanzee): 463582Help
Entry
463582            CDS       T01005                                 

Gene name
CYP3A4
Definition
cytochrome P450, family 3, subfamily A, polypeptide 4
Orthology
K17689  
cytochrome P450, family 3, subfamily A, polypeptide 4 [EC:1.14.13.32 1.14.13.67 1.14.13.97 1.14.13.157 1.14.13.-]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Bile secretion
Chemical carcinogenesis
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:ptr00140]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:ptr00591]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:ptr00830]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:ptr00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:ptr00982]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:ptr00983]
Organismal Systems; Digestive system; Bile secretion [PATH:ptr04976]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:ptr05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 503 aa AA seqDB search
MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYRKGFCMF
DMECHKKYGKVWGFYDGRQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISI
AEDEEWKRIRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREADTGKPVTLKDVFGAYS
MDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSIIVFPFLIPILEVLNICV
FPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSI
IFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVV
NETLRLFPVAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFS
KKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLRLG
GLLQPEKPIVLKVESRDGTVSGA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggctctcatcccagacttggccatggaaacctggcttctcctggctgtcagcctggtg
ctcctctatctatatggaacccattcacatggactttttaagaagcttggaattccaggg
cccacacctctgccttttttgggaaatattttgtcctaccgtaagggcttttgtatgttt
gacatggaatgtcataaaaagtatggaaaagtgtggggcttttatgatggtcgacagcct
gtgctggctatcacagatcctgacatgatcaaaacagtgctagtgaaagaatgttattct
gtcttcacaaaccggaggccttttggtccagtgggatttatgaaaagtgccatctctata
gctgaggatgaagaatggaagagaatacgatcattgctgtctccaaccttcaccagtgga
aaactcaaggagatggtccctatcattgcccagtatggagatgtgttggtgagaaatctg
aggcgggaagcagacacaggcaagcctgtcaccttgaaagacgtctttggggcctacagc
atggatgtgatcactagcacatcatttggagtgaacatcgactctctcaacaatccacaa
gacccctttgtggaaaacaccaagaagcttttaagatttgattttttggatccattcttt
ctctcaataatagtctttccattcctcatcccaattcttgaagtattaaatatctgtgtg
tttccaagagaagttacaaattttttaagaaaatctgtaaaaaggatgaaagaaagtcgc
ctcgaagatacacaaaagcaccgagtggatttccttcagctgatgattgactctcagaat
tcaaaagaaactgagtcccacaaagctctgtccgatctggagctcgtggcccaatcaatt
atctttatttttgctggctatgaaaccacgagcagtgttctctccttcattatgtatgaa
ctggccactcaccctgatgtccagcagaaactgcaggaggaaattgatgcagttttaccc
aataaggcaccacccacctatgatactgtgctacagatggagtatcttgacatggtggtg
aatgaaacactcagattattcccagttgctatgagacttgagagggtctgcaaaaaagat
gttgagatcaatgggatgttcattcccaaaggggtggtggtgatgattccaagctatgct
cttcaccgtgacccaaagtactggacagagcctgagaagttcctccctgaaagattcagc
aagaagaacaaggacaacatagatccttacatatacacaccctttggaagtggacccaga
aactgcattggcatgaggtttgctctcatgaacatgaaacttgctctaatcagagtcctt
cagaacttctccttcaaaccttgtaaagaaacacagatccccctgaaattacgcttagga
ggacttcttcaaccagaaaaacccattgttctaaaggttgagtcaagggatggcaccgta
agtggagcctga

DBGET integrated database retrieval system