KEGG   Pan troglodytes (chimpanzee): 463582Help
Entry
463582            CDS       T01005                                 

Gene name
CYP3A4
Definition
cytochrome P450, family 3, subfamily A, polypeptide 4
Orthology
K17689  
cytochrome P450, family 3, subfamily A, polypeptide 4 [EC:1.14.13.32 1.14.13.67 1.14.13.97 1.14.13.157 1.14.13.-]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Bile secretion
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    463582 (CYP3A4)
   00591 Linoleic acid metabolism
    463582 (CYP3A4)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    463582 (CYP3A4)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    463582 (CYP3A4)
   00982 Drug metabolism - cytochrome P450
    463582 (CYP3A4)
   00983 Drug metabolism - other enzymes
    463582 (CYP3A4)
 Organismal Systems
  Digestive system
   04976 Bile secretion
    463582 (CYP3A4)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    463582 (CYP3A4)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.32  albendazole monooxygenase
     463582 (CYP3A4)
    1.14.13.67  quinine 3-monooxygenase
     463582 (CYP3A4)
    1.14.13.97  taurochenodeoxycholate 6alpha-hydroxylase
     463582 (CYP3A4)
    1.14.13.157  1,8-cineole 2-exo-monooxygenase
     463582 (CYP3A4)
    1.14.13.-  
     463582 (CYP3A4)
Cytochrome P450 [BR:ptr00199]
 Cytochrome P450, animal type
  CYP3 family
   463582 (CYP3A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 503 aa AA seqDB search
MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYRKGFCMF
DMECHKKYGKVWGFYDGRQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISI
AEDEEWKRIRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREADTGKPVTLKDVFGAYS
MDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSIIVFPFLIPILEVLNICV
FPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSI
IFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVV
NETLRLFPVAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFS
KKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLRLG
GLLQPEKPIVLKVESRDGTVSGA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggctctcatcccagacttggccatggaaacctggcttctcctggctgtcagcctggtg
ctcctctatctatatggaacccattcacatggactttttaagaagcttggaattccaggg
cccacacctctgccttttttgggaaatattttgtcctaccgtaagggcttttgtatgttt
gacatggaatgtcataaaaagtatggaaaagtgtggggcttttatgatggtcgacagcct
gtgctggctatcacagatcctgacatgatcaaaacagtgctagtgaaagaatgttattct
gtcttcacaaaccggaggccttttggtccagtgggatttatgaaaagtgccatctctata
gctgaggatgaagaatggaagagaatacgatcattgctgtctccaaccttcaccagtgga
aaactcaaggagatggtccctatcattgcccagtatggagatgtgttggtgagaaatctg
aggcgggaagcagacacaggcaagcctgtcaccttgaaagacgtctttggggcctacagc
atggatgtgatcactagcacatcatttggagtgaacatcgactctctcaacaatccacaa
gacccctttgtggaaaacaccaagaagcttttaagatttgattttttggatccattcttt
ctctcaataatagtctttccattcctcatcccaattcttgaagtattaaatatctgtgtg
tttccaagagaagttacaaattttttaagaaaatctgtaaaaaggatgaaagaaagtcgc
ctcgaagatacacaaaagcaccgagtggatttccttcagctgatgattgactctcagaat
tcaaaagaaactgagtcccacaaagctctgtccgatctggagctcgtggcccaatcaatt
atctttatttttgctggctatgaaaccacgagcagtgttctctccttcattatgtatgaa
ctggccactcaccctgatgtccagcagaaactgcaggaggaaattgatgcagttttaccc
aataaggcaccacccacctatgatactgtgctacagatggagtatcttgacatggtggtg
aatgaaacactcagattattcccagttgctatgagacttgagagggtctgcaaaaaagat
gttgagatcaatgggatgttcattcccaaaggggtggtggtgatgattccaagctatgct
cttcaccgtgacccaaagtactggacagagcctgagaagttcctccctgaaagattcagc
aagaagaacaaggacaacatagatccttacatatacacaccctttggaagtggacccaga
aactgcattggcatgaggtttgctctcatgaacatgaaacttgctctaatcagagtcctt
cagaacttctccttcaaaccttgtaaagaaacacagatccccctgaaattacgcttagga
ggacttcttcaaccagaaaaacccattgttctaaaggttgagtcaagggatggcaccgta
agtggagcctga

DBGET integrated database retrieval system