KEGG   Pan troglodytes (chimpanzee): 463711Help
Entry
463711            CDS       T01005                                 

Gene name
FLNC
Definition
filamin C, gamma
Orthology
K04437  
filamin
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    463711 (FLNC)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    463711 (FLNC)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    463711 (FLNC)
  Infectious diseases
   05132 Salmonella infection
    463711 (FLNC)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   463711 (FLNC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 2692 aa AA seqDB search
MMNNSGYSDAGLGLGDETDEMPSTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVGKRLTDL
QRDLSDGLRLIALLEVLSQKRMYRKFHPRPNFRQMKLENVSVALEFLEREHIKLVSIDSK
AIVDGNLKLILGLIWTLILHYSISMPMWEDEDDEDARKQTPKQRLLGWIQNKVPQLPITN
FNRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVENAREAMQQADDWLGVPQVIAPEEI
VDPNVDEHSVMTYLSQFPKAKLKPGAPVRSKQLNPKKAIAYGPGIEPQGNTVLQPAHFTV
QTVDAGVGEVLVYIEDPEGHTEEAKVVPNNDKDRTYAVSYVPKVAGLHKVTVLFAGQNIE
HSPFEVNVGMALGDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQGR
RDTVEVALEDKGDSTFRCTYRPAMEGPHTVHVAFAGAPITRSPFPVHVSEACNPNACRAS
GRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVKVREAGDGVFECEYYPV
VPGKYVVTITWGGYAIPRSPFEVQVSPEAGVQKVRAWGPGLETGQVGKSADFVVEAIGTE
VGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHILP
APPDCFPDKVKAFGPGLEPTGCIVDKPAEFTIDARAAGKGDLKLYAQDADGCPIDIKVIP
NGDGTFRCSYVPTKPIKHTIIISWGGVNVPKSPFRVNVGEGSHPERVKVYGPGVEKTGLK
ANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGR
YTIMVLFANQEIPASPFHIKVDPSHDASKVKAEGPGLNRTGVEVGKPTHFTVLTKGAGKA
KLDVQFAGTAKGEVVRDFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVNV
APPLDLSKIKVQGLNSKVAVGQEQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCKLEPGGG
AEAQAVRYMPPEEGPYKVDITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGLVGTP
APFSIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAHI
PGSPFKATIRPVFDPSKVRASGPGLERGKVGEAATFTVDCSEAGEAELTIEILSDAGVKA
EVLIHNNADGTYHITYSPAFPGTYTITIKYGGHPVPKFPTRVHVQPAVDTSGVKVSGPGV
EPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAYE
EGVHLVEVLYDEVAVPKSPFRVGVTEGCDPTRVRAFGPGLEGGLVNKANRFTVETRGAGT
GGLGLAIEGPSEAKMSCKDNKDGSCTVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKDV
VDPGKVKCSGPGLGAGVRARVPQTFTVDCSQAGRAPLQVAVLGPTGVAEPVEVRDNGDGT
HTVHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPAHDASKVRASGPGLNASGIPASLPV
EFTIDARDAGEGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDISGRYTITIKYGGDE
IPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGQETVITVDAKAAGEGKVTC
TVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLATEEPVV
PVEPMESMLRPFNLVIPFAVQKGELTGEVRMPSGKTARPNITDNKDGTITVRYAPTEKGL
HQMGIKYDGNHIPGSPLQFYVDAINSRHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLS
LAVEGPSKAEITCKDNKDGTCTVSYLPTAPGDYSIIVRFDDKHIPGSPFTAKITGDDSMR
TSQLNVGTSTDVSLKITESDLSQLTASIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEH
VVSVRKSGKHVTNSPFKILVGPSEIGDASKVRVWGKGLSEGHTFQVAEFIVDTRNAGYGG
LGLSIEGPSKVDINCEDMEDGTCKVTYCPTEPGTYIINIKFADKHVPGSPFTVKVTGEGR
MKESITRRRQAPSIATIGSTCDLNLKIPGNWFQMVSAQERLTRTFTRSSHTYTRTERTEI
SKTRGGETKREVRVEESTQVGGDPFPAVFGDFLGRERLGSFGSITRQQEGEASSQDMTAQ
VTSPSGKMEAAEIVEGEDSAYSVRFVPQEMGPHTVAVKYRGQHVPGSPFQFTVGPLGEGG
AHKVRAGGTGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSCGVSY
VVQEPGDYEVSIKFNDEHIPDSPFVVPVASLSDDARRLTVTSLQETGLKVNQPASFAVQL
NGARGVIDARVHTPSGAVEECYVSELDSDKHTIRFIPHENGVHSIDVKFNGAHIPGSPFK
IRVGEQSQAGDPGLVSAYGPGLEGGTTGVSSEFIVNTLNAGSGALSVTIDGPSKVQLDCR
ECPEGHVVTYTPMAPGNYLIAIKYGGPQHIVGSPFKAKVTGPRLSGGHSLHETSTVLVET
VTKSSSSRGSSYSSIPKFSSDASKVVTRGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVH
GPKTPCEEVYVKHMGNRVYNVTYTVKEKGDYILIVKWGDESVPGSPFKVKVP
NT seq 8079 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacaacagcggctactcagacgccggcctcggcctgggcgatgagacagacgag
atgccgtccacggagaaggacctggcggaggacgcgccgtggaagaagatccagcagaac
acattcacgcgctggtgcaatgagcacctcaagtgcgtgggcaagcgcctgaccgacctg
cagcgcgacctcagcgacgggctccggctcatcgcgctgctcgaggtgctcagccagaag
cgcatgtaccgcaagttccatccgcgccccaacttccgccaaatgaagctggagaacgtg
tccgtggccctcgagttcctcgagcgcgagcacatcaagctcgtgtccatagacagcaag
gccatcgtggatgggaacctgaagctgatcctgggcctgatctggacgctgatcctgcac
tactccatctccatgcccatgtgggaggatgaagatgatgaggatgcccgcaaacagacg
cccaagcagcggctgcttggctggatccagaacaaggtgccccagctgcccatcaccaac
ttcaaccgtgactggcaggacggcaaagctctgggcgccctggtggacaactgcgccccc
ggtctctgccccgactgggaggcctgggaccccaaccagcccgtggagaacgcccgggag
gccatgcagcaggccgacgactggcttggggtgccccaggtcattgcccctgaggagatc
gtggaccccaacgtggatgagcattctgttatgacctacctgtcccagttccccaaggcc
aagctcaaacctggcgcccctgttcgatccaagcagctgaaccccaagaaagccatcgcc
tatgggcctggcatcgagccacagggcaacactgtgctgcagcctgcccacttcaccgtg
cagacggtggacgcgggcgtgggcgaggtgctggtctacatcgaggaccctgaaggccac
actgaggaggccaaggtggttcccaacaatgacaaggatcgcacctatgctgtctcctat
gtgcccaaggtcgctgggttacacaaggtgaccgtgctctttgctggccagaacattgaa
cacagtccctttgaggtgaacgtgggcatggccctgggagatgccaacaaggtgtcagcc
cgtggccctggcctggaacctgtgggcaatgtggccaacaaacccacctactttgacatc
tacactgcgggggctggcactggtgatgttgctgtggtgatcgtggacccacagggccgg
cgggacacagtggaggtggccctggaggacaagggtgacagcacgttccgctgcacatac
agacctgccatggaggggccacataccgtgcatgtggcctttgcgggtgcccccatcacc
cgcagtcccttccctgtccatgtgtcggaagcctgtaaccccaacgcctgccgcgcctct
gggcgaggcctgcagcccaagggtgttcgcgtgaaagaggtggctgacttcaaggtgttt
accaagggtgccggcagcggggagctcaaggtcacggtcaaggggccaaagggcacagag
gagccagtgaaggtgcgggaggctggggacggtgtgttcgagtgcgagtactacccggtg
gtgcctgggaagtatgtggtgaccatcacgtggggcggctacgccatccctcgcagcccc
tttgaggtacaggtgagcccagaggcaggagtgcaaaaggtccgggcctggggtcctggt
ttggagactggccaggtgggcaagtcagccgattttgtggtggaagccattggcaccgag
gtggggacactgggcttctccatcgaggggccctcacaagccaagatcgaatgtgacgac
aagggggatggctcctgcgatgtgcggtactggcccacggagcccggggagtacgctgtg
cacgtcatctgtgacgatgaggacatccgagactcacccttcattgcccacatcctgccc
gccccacctgactgcttcccagataaggtgaaggcctttgggcctggcctggagcctacc
ggctgcatcgtggacaagcccgctgagttcaccattgatgctcgtgcagctggcaaggga
gacctgaagctctatgcccaggacgccgacggctgtcccatcgacatcaaggtgatcccc
aacggcgacggcaccttccgctgctcctacgtgcccaccaagcccattaagcacaccatc
atcatctcctggggaggcgtaaacgtgcccaagagccccttccgggtgaacgtgggcgag
ggcagccaccccgagcgggtaaaggtgtacggccctggagtggagaagacgggcctcaag
gccaacgagcccacctacttcacggtggactgcagtgaggcggggcaaggcgacgtgagc
attggcatcaagtgcgccccaggcgtggtgggccctgcagaggctgacatcgacttcgac
atcatcaagaatgacaatgacaccttcaccgtcaagtacacgccaccaggggcgggccgc
tacaccatcatggtgctgtttgccaaccaggagatccccgccagccccttccacatcaag
gtggacccatcccacgatgccagcaaagtcaaggccgagggccctgggctgaatcgcaca
ggtgtggaagtcgggaagcccacccacttcacggtgctgaccaagggagccggcaaggcc
aagctggatgtgcagtttgcagggacagccaagggcgaggttgtgcgggactttgagatc
atagacaaccatgactactcctacactgtcaagtacaccgctgtccagcagggcaacatg
gcagtgacagtgacctacggcggggaccctgtccccaagagcccctttgtggtgaatgtg
gcacccccgctggacctcagcaaaatcaaagttcagggccttaatagcaaggtggctgtg
ggacaggaacaagcattctctgtgaacacacgaggggctggcggtcagggccaactggat
gtgcggatgacttcgccctctcgccggcccatcccctgcaagctggagccaggcggtgga
gcggaagcccaggctgtgcgctacatgcccccggaggaggggccctacaaggtggatatc
acctacgatggtcacccggtgcctggcagcccctttgctgtggagggtgtcctgccccct
gatccctccaaggtctgtgcttatggccccggtctcaagggtggactggtaggcaccccc
gcgccattctccatcgacaccaagggggctggcacaggtggcctggggctgaccgtggag
ggcccctgcgaggccaagatcgagtgccaggacaatggtgatggctcatgtgctgtcagc
tacctgcccacggagcctggcgagtacaccatcaacatcctgtttgctgaagcccacatc
cctggttcgcccttcaaagccaccattcggcctgtgtttgacccgagcaaggtgcgggcc
agtggaccgggcctggagcgcggcaaggtcggtgaggcagccaccttcactgtggactgc
tcagaggcaggcgaggcggagctgaccattgagatcctgtcggacgccggggtcaaggcc
gaggtgctgatccacaacaacgcggatggcacctaccacatcacctacagccccgccttc
cctggcacctacaccattaccatcaagtatggcgggcatcccgtgcccaaattccccacc
cgtgtccatgtgcagcctgcggtcgataccagtggcgtcaaggtctcagggcctggtgtt
gagccacacggtgtcctgcgggaggtgaccactgagttcactgtggatgcaagatcccta
acagccacaggcggcaaccacgtgacggctcgcgtgctcaacccctcgggggccaagaca
gacacctatgtgacagacaatggggatggcacctaccgagtacagtacaccgcctacgag
gagggcgtgcatttggtggaggtcctgtatgatgaggtcgctgtgcccaagagccccttc
cgagtgggcgtgaccgagggctgtgatcccacccgcgtccgagccttcgggccaggcctg
gagggtggcttggtcaacaaggccaaccgcttcactgtggagaccaggggagcgggcacc
gggggccttggcctagccatcgagggtccctcggaagccaagatgtcctgcaaggacaac
aaggatggtagctgcaccgtggagtacatccccttcactcctggagactatgacgtcaac
atcaccttcggggggcggcccatcccagggagcccgttccgcgtgccagtgaaggatgtg
gtggaccctgggaaggtgaagtgctcagggccagggctgggggctggtgtcagggcccgg
gttcctcagaccttcacagtggactgcagtcaagctggccgggcgcccctgcaggtggct
gtgctgggccccacaggtgtggccgagcctgtggaggtgcgggacaatggagatggcacc
cacactgtccactacaccccagccactgacgggccctacacggtagccgtcaagtatgct
gaccaggaggtgccacgcagccccttcaagatcaaggtcctcccagctcatgatgccagc
aaggtgcgggccagcggcccaggcctcaacgcctctggcatccctgccagcctgcctgtg
gagttcaccattgacgcacgggacgcgggcgaggggttgctcactgtccagatcttggac
cccgagggtaagcccaagaaggccaacatccgggacaatggggatggcacatacaccgtg
tcctacctgccggacataagcggccggtacaccatcaccatcaagtatggtggtgacgag
atcccctactcgcccttccgcatccatgctctgcccactggggatgccagcaagtgcctc
gtcacagtgtccattggaggccatggcctgggtgcctgcctgggcccccggatccagatt
gggcaggagacggtgatcacggtggatgccaaggcagccggtgaggggaaggtgacatgc
acggtgtccacgccggatggggcagagctcgatgtggatgtggttgagaaccatgacggt
acctttgacatctactacacagcgcccgagccgggcaagtacgtcatcaccatccgcttc
gggggcgagcacatccccaacagccccttccacgtgctggccacagaggagccagtggtg
cctgtggagccaatggagtccatgctgaggcccttcaacctggtcatccccttcgcggtg
cagaaaggggagctcacaggagaggtgcggatgccctcggggaagacggcacggcccaac
atcaccgacaacaaggacggcaccatcacggtgaggtatgcacccaccgagaaaggcctg
caccagatggggatcaagtatgacggcaaccacatccctgggagccccttacagttctat
gtggatgccatcaacagccgccatgtcagtgcctatgggccaggcctgagccatggcatg
gtcaacaagccagccaccttcactattgtcaccaaagatgctggagaagggggtctgtca
ctggccgtggagggcccatccaaggcagagatcacctgtaaggacaacaaggatggcacc
tgcaccgtgtcctatctgccgaccgcgcctggagactacagcatcatcgtgcgcttcgat
gacaagcacatcccggggagccccttcacagccaagatcacaggtgatgactccatgagg
acctcacagctgaatgtgggcacctccacggacgtgtcactgaagatcaccgagagtgat
ctgagccagctgaccgccagcatccgtgccccctcgggcaacgaggagccctgcctgctg
aagcgcctgcccaaccggcacattgggatctccttcacccccaaggaggtcggggagcac
gtggtgagcgtgcgcaagagtggcaagcacgtcaccaacagccccttcaagatcctggtg
gggccatctgagatcggggacgccagcaaggtgcgggtctggggcaagggcctttccgag
ggacacacgttccaggtggcagagttcatcgtggacactcgcaatgcaggttatgggggc
ttggggctgagtattgaaggcccaagcaaggtggacatcaactgtgaggacatggaggac
gggacatgcaaagtcacctactgccccaccgagcccggcacctacatcatcaacatcaag
tttgctgacaagcacgtgcctggaagccccttcactgtgaaggtgaccggcgagggccgc
atgaaggagagcatcacccggcggagacaggcaccttccatcgccaccattggcagcacc
tgtgacctcaacctcaagatcccgggaaactggttccagatggtgtctgcccaggagcgc
ctgacacgcaccttcacacgcagcagccacacctacacccgcacggagcgcacggagatc
agcaagacgcggggcggggagacaaagcgcgaggtgcgggtggaggagtccacccaggtc
ggcggggaccccttccctgctgtgtttggggacttcctgggccgggagcgcctgggatcc
ttcggcagcatcacccggcagcaggagggtgaggccagctctcaggacatgactgcacag
gtgaccagcccatcgggcaagatggaagccgcagagatcgtcgagggcgaggacagcgcc
tacagcgtgcgctttgtgccccaggagatggggccccatacggtcgctgtcaagtaccgt
ggccagcacgtgcccggcagcccctttcagttcactgtggggccgctgggtgaaggtggt
gcccacaaggtgcgggccggaggcacagggctggagcgaggtgtggccggcgtgccagcc
gagttcagcatctggacccgggaggctggcgctgggggcctgtccattgctgtggagggt
cctagcaaagcggagattgcatttgaggatcgcaaagatggctcctgcggcgtctcctat
gtcgtccaggaaccaggtgactatgaggtctccatcaagttcaatgatgagcacatccca
gacagcccctttgtggtgcctgtggcctccctctcggatgacgctcgccgtctcactgtc
accagcctccaggagacggggctcaaggtgaaccagccagcgtcctttgccgtgcagctg
aacggtgcccggggcgtgattgatgcccgggtgcacacaccctcgggggctgtggaggag
tgctacgtctctgagctggacagtgacaagcacaccatccgcttcatcccccacgagaat
ggcgtccactccatcgatgtcaagttcaatggtgcccacatccctggaagtcccttcaag
atccgcgttggggagcagagccaggctggggacccaggcttggtgtcagcctacggtcct
gggctcgagggaggcactaccggtgtgtcatcagagttcatcgtgaacaccctgaatgcc
ggctcgggggccttgtctgtcaccattgatggcccctccaaggtgcagctggactgtcgg
gagtgtcctgagggccatgtggtcacttacactcccatggcccctggcaactacctcatt
gccatcaagtacggtggcccccagcacatcgtgggcagcccctttaaggccaaggtcact
ggtccgaggctgtccggaggccacagccttcacgaaacatccacggttctggtggagact
gtgaccaagtcctcctcaagccggggctccagctacagctccatccccaagttctcctca
gatgccagcaaggtggtgactcggggccctgggctgtcccaggccttcgtgggccagaag
aactccttcaccgtggactgcagcaaagcaggcaccaacatgatgatggtgggcgtgcac
ggccccaagaccccctgtgaggaggtgtacgtgaagcacatggggaaccgggtgtacaat
gtcacctacactgtcaaggagaaaggggactacatcctcattgtcaagtggggtgacgaa
agtgtccctggaagccccttcaaagtcaaggtcccttga

DBGET integrated database retrieval system