KEGG   Pan troglodytes (chimpanzee): 463774Help
Entry
463774            CDS       T01005                                 

Gene name
TBXAS1
Definition
thromboxane A synthase 1 (platelet)
Orthology
K01832  
thromboxane-A synthase [EC:5.3.99.5]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ptr00590]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 466 aa AA seqDB search
MELRKLYGPLCGYYLGRRMFIVISEPDMIKQVLVENFSNFTNRMASGLEFKSVADSVLFL
RDKRWEEVRGALMSAFSPEKLNEMVPLISQACNLLLAHLKRYAESGDAFDIQRCYCNYTT
DVVASVAFGTPVDSWQAPEDPFVKHCKRFFEFCIPRPILVLLLSFPSIMVPLARILPNKN
RDELNGFFNKLIRNVIALRDQQAAEERRRDFLQMVLDARHSASPMGVQDFDIVREVFSST
GCKPNPSRQHQPSSMARPLTVDEIVGQAFIFLIAGYEIVTNTLSFATYLLATNPDCQEKL
LREVDVFKEKHMAPEFCSLKEGLPYLDMVIAETLRMYPPAFRFTREAAQDCEVLGQRIPA
GAVLEMAVGALHHDPEHWPSPETFNPERFTAEARQQHRPFTYLPFGAGPRSCLGVRLGLL
EVKLTLLHVLHKFRFQACPETQVPLQLESKSALGPKNGVYIKIVSR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggagctcagaaagctgtatggacctctgtgtgggtactatcttggtcgtcggatgttt
attgttatttctgagccagacatgatcaagcaggtgttggttgagaacttcagtaacttt
accaacagaatggcgtcgggtttggagttcaagtcggtagccgacagcgttctgttttta
cgtgacaaaagatgggaagaggtcagaggtgccctgatgtctgctttcagtcctgaaaag
ctgaacgagatggttcccctcatcagccaagcctgcaaccttctcctggctcatttaaaa
cgctatgcggaatctggggacgcatttgacatccagaggtgctactgcaattacaccaca
gatgtggttgccagcgtcgcctttggcaccccggtggactcctggcaggcccctgaggat
ccctttgtgaaacactgcaagcgtttcttcgaattctgcatccccagacctatcctggtt
ttactcttatcatttccatccataatggtcccactggcccggattttgcccaataagaac
cgagatgaactgaatggcttttttaacaaactcattaggaatgtgattgccttgcgggac
cagcaagctgccgaagagaggcggagagacttcctccaaatggtcctggatgcccgacat
tctgcaagtcccatgggcgtgcaagactttgacatcgttagagaagttttctcctctact
gggtgcaagccgaacccttcccggcaacaccagcccagctccatggccaggcctttgact
gtggatgagattgtgggccaggccttcatcttcctcatcgctggctatgaaattgtcacc
aacacactttcttttgccacctacctactggccaccaaccctgactgccaagagaagctt
ctgagagaggtggacgtttttaaggagaaacacatggcccctgagttctgcagcctcaag
gaaggcctgccctatctggacatggtgattgcagagacgctgaggatgtacccgccagct
ttcagattcacacgggaggcagctcaggactgcgaggtgctggggcagcgcatccccgca
ggcgctgtgctagagatggccgtgggtgccctgcaccatgaccctgagcactggccaagc
ccggagaccttcaaccctgaaaggttcacggctgaggcccggcagcagcaccggcccttc
acgtacctgcccttcggggccggcccacggagctgcctcggggtgcgtctagggctgctt
gaggtcaagttgacactgctccacgtgctgcacaagttccggttccaagcctgccctgag
acccaggtaccgctgcagctagaatccaaatctgccctaggtccaaaaaatggtgtctat
atcaagattgtatcccgctga

DBGET integrated database retrieval system