KEGG   Pan troglodytes (chimpanzee): 463774Help
Entry
463774            CDS       T01005                                 

Gene name
TBXAS1
Definition
thromboxane A synthase 1 (platelet)
Orthology
K01832  
thromboxane-A synthase [EC:5.3.99.5]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Platelet activation
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    463774 (TBXAS1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    463774 (TBXAS1)
Enzymes [BR:ptr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.5  thromboxane-A synthase
     463774 (TBXAS1)
Cytochrome P450 [BR:ptr00199]
 Cytochrome P450, animal type
  CYP5 family
   463774 (TBXAS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 466 aa AA seqDB search
MELRKLYGPLCGYYLGRRMFIVISEPDMIKQVLVENFSNFTNRMASGLEFKSVADSVLFL
RDKRWEEVRGALMSAFSPEKLNEMVPLISQACNLLLAHLKRYAESGDAFDIQRCYCNYTT
DVVASVAFGTPVDSWQAPEDPFVKHCKRFFEFCIPRPILVLLLSFPSIMVPLARILPNKN
RDELNGFFNKLIRNVIALRDQQAAEERRRDFLQMVLDARHSASPMGVQDFDIVREVFSST
GCKPNPSRQHQPSSMARPLTVDEIVGQAFIFLIAGYEIVTNTLSFATYLLATNPDCQEKL
LREVDVFKEKHMAPEFCSLKEGLPYLDMVIAETLRMYPPAFRFTREAAQDCEVLGQRIPA
GAVLEMAVGALHHDPEHWPSPETFNPERFTAEARQQHRPFTYLPFGAGPRSCLGVRLGLL
EVKLTLLHVLHKFRFQACPETQVPLQLESKSALGPKNGVYIKIVSR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggagctcagaaagctgtatggacctctgtgtgggtactatcttggtcgtcggatgttt
attgttatttctgagccagacatgatcaagcaggtgttggttgagaacttcagtaacttt
accaacagaatggcgtcgggtttggagttcaagtcggtagccgacagcgttctgttttta
cgtgacaaaagatgggaagaggtcagaggtgccctgatgtctgctttcagtcctgaaaag
ctgaacgagatggttcccctcatcagccaagcctgcaaccttctcctggctcatttaaaa
cgctatgcggaatctggggacgcatttgacatccagaggtgctactgcaattacaccaca
gatgtggttgccagcgtcgcctttggcaccccggtggactcctggcaggcccctgaggat
ccctttgtgaaacactgcaagcgtttcttcgaattctgcatccccagacctatcctggtt
ttactcttatcatttccatccataatggtcccactggcccggattttgcccaataagaac
cgagatgaactgaatggcttttttaacaaactcattaggaatgtgattgccttgcgggac
cagcaagctgccgaagagaggcggagagacttcctccaaatggtcctggatgcccgacat
tctgcaagtcccatgggcgtgcaagactttgacatcgttagagaagttttctcctctact
gggtgcaagccgaacccttcccggcaacaccagcccagctccatggccaggcctttgact
gtggatgagattgtgggccaggccttcatcttcctcatcgctggctatgaaattgtcacc
aacacactttcttttgccacctacctactggccaccaaccctgactgccaagagaagctt
ctgagagaggtggacgtttttaaggagaaacacatggcccctgagttctgcagcctcaag
gaaggcctgccctatctggacatggtgattgcagagacgctgaggatgtacccgccagct
ttcagattcacacgggaggcagctcaggactgcgaggtgctggggcagcgcatccccgca
ggcgctgtgctagagatggccgtgggtgccctgcaccatgaccctgagcactggccaagc
ccggagaccttcaaccctgaaaggttcacggctgaggcccggcagcagcaccggcccttc
acgtacctgcccttcggggccggcccacggagctgcctcggggtgcgtctagggctgctt
gaggtcaagttgacactgctccacgtgctgcacaagttccggttccaagcctgccctgag
acccaggtaccgctgcagctagaatccaaatctgccctaggtccaaaaaatggtgtctat
atcaagattgtatcccgctga

DBGET integrated database retrieval system