KEGG   Pan troglodytes (chimpanzee): 463789Help
Entry
463789            CDS       T01005                                 

Gene name
MGAM
Definition
maltase-glucoamylase, intestinal-like
Orthology
K12047  
maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    463789 (MGAM)
   00500 Starch and sucrose metabolism
    463789 (MGAM)
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    463789 (MGAM)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     463789 (MGAM)
    3.2.1.20  alpha-glucosidase
     463789 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 1857 aa AA seqDB search
MARKKLKKFTTLEIVLSVLLLVLFIISIVLIVLLAKESLKSTAPDPGTTGTPDPGTTGTP
DPGTTGTTHPRTTGPPDPGTTATTPVSAECPVVNELERINCIPDQPPTKATCDQRGCCWN
PQGAVSVPWCYYSKNHSYHMEGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTS
NRFHFKLTDQTNNRFEVPHEHMQSFSGNAASSLTYQVEISRQPFSIKVTRRSNNRVLFDS
SIGPLLFADQFLQLSTRLPSANVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLY
GAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVV
QEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDER
RDFTYDPVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNS
SDGVTPLIGEVWPGQSVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGS
VSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDVHNLYGYSMAVATAEAAKT
VFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICG
FALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLL
PYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAY
VPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGL
IIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNHLEVNISQSTYKDPNNLAFN
EIKILGTEEPSNVTVKHNGVPSQTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWSIKIRD
EEKIDCYPDENGASAENCTARGCIWEASNSSGVPFCYFVNDLYSVSDVQYNSHGATADIS
LKSSIYANAFPSTPVNPLRLDVTYHKNEMLQFKIYDPNNNRYEVPVPLNIPSVPSSTPEG
QLYDVLIKKNPFGIEIRRKSTGTIIWDSQLLGFTFNDMFIRISTRLPSKYLYGFGETEHR
SYRRDLEWHTWGMFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVLLLNSNAMDVTFQPL
PALTYRTTGGVLDFYVFLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDSEIA
SLYDEMVAAQIPYDVQYSDIDYMERQLDFTLSPKFAGFPALINRMKADGMRVILILDPAI
SGNETQPYPAFTRGVEDDVFIKYPNDGDIVWGKVWPDFPDVVVNGSLDWDSQVELYRAYV
AFPDFFRNSTGKWWKREIEELYNNPQNPERSLKFDGMWIDMNEPSSFVNGAVSPGCRDAS
LNHPPYMPYLESRDRGLSSKTLCMESQQILPDGSLVQHYNVHNLYGWSQTRPTYEAVQEV
TGQRGVVITRSTFPSSGRWAGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGADICGFF
EDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWDVAFVNISRTVLQTRYTLLPYLY
TLMHKAHTEGITVVRPLLHEFVSDQVTWDIDSQFLLGPAFLVSPVLERNARNVTAYFPRA
RWYDYYTGVDINARGEWKTLPAPLDHINLHVRGGYILPWQEPALNTHLSRQKFMGFKIAL
DDEGTAGGWLFWDDGQSIDTYGKGLYYLASFSASQNTMQSHIIFNNYITGTNPLKLGYIE
IWGVGSVPITSVSISVSGMVITPSFNNDPTTQVLSIDVTDRNISLHNFTSLTWIITL
NT seq 5574 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaagctgaaaaaatttactactttggagattgtgctcagtgttcttctg
cttgtgttgtttatcatcagtattgttctaattgtgcttttagccaaagagtcactgaaa
tcaacagccccagatcctgggacaactggtaccccagatcctgggacaactggtacccca
gatcctggaacaactggtaccacacatcctaggacaacgggtcccccagatcctggaaca
actgctaccactcctgtttctgctgaatgtccagtggtaaatgaattggaacgaattaat
tgcatccctgaccagccgccaacaaaggccacatgtgaccaacgtggctgttgctggaat
ccccagggagctgtaagtgttccctggtgctactattccaagaatcatagctaccacatg
gagggcaaccttgtcaacacaaatgcaggattcacagcccggttgaaaaatctgccttct
tcacccgtgtttggaagcaatgttgacaatgttcttctcacagcagaatatcagacatct
aatcgtttccactttaagttgactgaccaaaccaataataggtttgaagtgccccacgaa
cacatgcagtccttcagtggaaatgctgcttcttctttgacctaccaagttgaaatctcc
agacagccatttagcatcaaagtgaccagaagaagcaacaatcgtgttttgtttgactcg
agcattgggcccctactgtttgccgaccagttcttgcagctctccactcgactgcctagc
gctaacgtgtatggcctgggagagcatgtgcaccagcagtatcggcatgatatgaattgg
aagacctggcccatatttaacagagacacaactcccaatggaaacggaactaatttgtat
ggtgcgcagacattcttcttgtgccttgaagatgctagtggattgtcctttggggtgttt
ctgatgaacagcaatgccatggaggttgtccttcagcctgcgccagccatcacttaccgc
accattgggggcattctcgacttctatgtgttcttgggaaacactccagagcaagttgtt
caagaatatctagagcttattgggcggccagcccttccctcctactgggcgcttggattt
cacctcagtcgttatgaatatggaaccttagacaacatgagggaagtcgtggagagaaat
cgcgcagcacagctcccttatgatgttcagcatgctgatattgattatatggatgagaga
agggacttcacttacgatccagtggattttaaaggcttccctgaatttgtcaacgagtta
cacaataatggacagaagcttgtcatcattgtggatccagccatctccaacaactcttcc
tcaagtaaaccctatggcccatatgacaggggttcagatatgaagatatgggtgaatagt
tcagatggagtgactccactcattggggaggtctggcctggacaaagtgtgtttcctgat
tataccaatcccaactgtgctgtttggtggacaaaggaatttgagctttttcacaatcaa
gtagagtttgatggaatctggattgatatgaatgaagtctccaactttgttgatggttcg
gtctcaggatgttccacaaacaacctaaataatcccccattcactcccagaatcctggat
gggtacctgttctgcaagactctctgtatggatgcagtgcagcactggggcaagcagtat
gacgttcacaatctgtatggctactccatggcggtcgccacagcagaagctgccaagact
gtgttccctaataagagaagcttcattctgacccgttctacctttgcgggctctggcaag
tttgcagcacattggttaggagacaacactgccacctgggacgacctgagatggtccatc
cctggcgtgcttgagttcaacctttttggcatcccaatggtgggtcctgacatatgtggc
tttgctttggacacccctgaggagctctgtaggcggtggatgcagttgggtgcattttat
ccgttttctagaaatcacaatggccaaggctacaaggaccaggatcctgcctcctttgga
gctgactccctgctgttgaattcctccaggcactaccttaacatccgctatactctattg
ccctacctatacaccctcttcttccgtgctcacagccgaggggacacagtggccaggccc
cttttgcatgagttctacgaggacaacagcacttgggatgtgcaccaacagttcttatgg
gggcccggtctcctcatcactccagttctggatgaaggtgcagagaaagtgatggcatat
gtgcctgatgctgtctggtatgactacgagactgggagccaagtgagatggaggaagcaa
aaagtcgagatggaacttcctggagacaaaattggacttcaccttcgaggaggctacatc
ttccccacacagcagccaaatacaaccactctggccagtcgaaagaaccctcttggtctt
atcattgccctagatgaaaacaaagaagcaaaaggagaacttttctgggatgatggggaa
acgaaggatactgtggccaataaagtgtatcttttatgtgagttttcagtcactcaaaac
cacttggaggtgaatatttcacaatcaacctacaaggaccccaataatttagcattcaat
gagattaaaattcttgggacggaggaaccaagcaatgttacggtgaaacacaatggtgtc
ccaagtcagacttctcctacagtcacttatgattctaacctgaaggttgccattatcaca
gatatcgatcttctcctgggagaagcatacacagtggaatggagcataaagataagggat
gaagaaaaaatagactgttaccctgatgagaatggtgcttctgcagaaaactgcactgcc
cgtggctgtatctgggaggcatccaattcttctggagtccctttttgctattttgtcaac
gacctatactctgtcagtgatgttcagtataattcccatggggccacagctgacatctcc
ttaaagtcttccatttatgccaatgctttcccctccacacccgtgaacccccttcgcctg
gatgtcacttaccataagaatgaaatgctgcagttcaagatttatgatcccaacaacaat
cggtatgaagttccagtccctctgaatatacccagtgtgccatccagcacccctgagggt
caactctatgatgtcctcattaagaagaatccatttgggattgaaattcgccggaagagt
acaggcactataatttgggactctcagctccttggcttcaccttcaatgacatgtttatc
cgcatctccacccgccttccctccaagtacctctatggctttggggaaactgagcacagg
tcctataggagagacttggagtggcacacttgggggatgttctcccgagaccagccccca
gggtacaagaagaattcctatggtgtccacccctactacatggggctggaggaggatggc
agtgcccatggagtgctcctgctgaacagcaatgccatggatgtgacgttccagcccctg
cctgccttgacataccgtaccacagggggagttctggacttttatgtgttcttggggcca
actccagagcttgtcacccagcagtacactgagttgattggccggcctgtgatggtacct
tactggtctttggggttccagctgtgtcgctatggataccagaacgattctgagatcgcc
agcttgtatgatgagatggtggctgcccagatcccttatgacgtgcagtactcagacatc
gactacatggagcggcagctggacttcaccctcagccccaagtttgctgggtttccagct
ctgatcaatcgcatgaaggctgatgggatgcgggtcatcctcattctggatccagccatt
tctggcaatgagacacagccttatcctgccttcactcggggcgtggaggatgacgtcttc
atcaagtacccaaatgatggagacattgtctggggaaaggtctggcctgattttcctgat
gttgttgtgaatgggtctctagactgggacagtcaagtggagctatatcgagcttatgtg
gccttcccagactttttccgtaattcaactggcaagtggtggaagagggaaatagaagaa
ctatacaacaatccacagaatccagagaggagcttgaagtttgatggcatgtggattgat
atgaatgaaccatcaagcttcgtgaatggggcagtttctccaggctgcagggacgcctct
ctgaaccaccctccctacatgccgtatttggagtccagggacaggggcctgagcagcaag
accctgtgcatggagagtcagcagatcctcccagacggctccctggtgcagcactacaac
gtgcacaacctgtatgggtggtcccagaccagacctacatacgaagccgtgcaggaggtg
acgggacagcgaggggtcgtcatcacccgctccacatttccctcttctggccgctgggca
ggacattggctgggagacaacacggccgcgtgggatcagctgaagaaatctatcattggc
atgatggagttcagcctcttcggcatatcctatacgggagcagatatctgtgggttcttt
gaagatgctgaatatgagatgtgtgttcgctggatgcagctgggggccttttaccccttc
tcaagaaaccacaacaccattgggaccaggagacaagaccctgtgtcctgggatgttgct
tttgtgaacatttccagaactgtcctgcagaccagatacaccttgttgccatatctgtat
accttgatgcataaggcccacacggagggcatcactgttgtgcggcctctgctccatgag
tttgtgtcagaccaggtgacatgggacatagacagtcagttcctgctgggcccagccttc
ctggtcagccctgtcctggagcgcaatgccagaaatgtcactgcatatttccctagagcc
cgttggtacgattactacacgggtgtggatattaatgcaagaggagagtggaagaccttg
ccagcccctcttgaccacattaatcttcatgtccgtgggggctacatcctgccctggcaa
gagcctgcactgaacacccacttaagccgccagaaattcatgggcttcaaaattgccttg
gatgatgaaggaactgctgggggctggctcttctgggatgatgggcaaagcattgatacc
tatgggaaaggactctattacttggccagcttttctgccagccagaatacgatgcaaagc
catataattttcaacaattacatcactggtacaaatcctttgaaactgggctacattgaa
atctggggagtgggcagtgtccccattaccagtgtcagcatctctgtgagtggcatggtc
ataacaccctccttcaacaatgaccccacgacacaggtattaagcatcgatgtgactgac
agaaacatcagcctacataattttacttcattgacgtggataatcactctgtga

DBGET integrated database retrieval system