KEGG   Pan troglodytes (chimpanzee): 463891Help
Entry
463891            CDS       T01005                                 

Gene name
CDK5
Definition
cyclin-dependent kinase 5
Orthology
K02090  
cyclin-dependent kinase 5 [EC:2.7.11.22]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Axon guidance
Alzheimer's disease
Cocaine addiction
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Organismal Systems
  Development
   04360 Axon guidance
    463891 (CDK5)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    463891 (CDK5)
  Substance dependence
   05030 Cocaine addiction
    463891 (CDK5)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     463891 (CDK5)
Protein kinases [BR:ptr01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   463891 (CDK5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 260 aa AA seqDB search
MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKH
KNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKNGELKLADFGLARAFG
IPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQL
KRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPV
QRISAEEALQHPYFSDFCPP
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaatacgagaaactggaaaagattggggaaggcacctacggaactgtgttcaag
gccaaaaaccgggagactcatgagatcgtggctctgaaacgggtgaggctggatgacgat
gatgagggtgtgccgagttcagccctccgggagatctgcctactcaaggagctgaagcac
aagaacatcgtcaggcttcatgatgtcctgcacagcgacaagaagctgactttggttttt
gaattctgtgaccaggacctgaagaagtattttgacagttgcaatggtgacctcgatcct
gagattgtaaagaatggggagctgaaattggctgattttggcctggctcgagcctttggg
attcccgtccgctgttactcagctgaggtggtcacactgtggtaccgcccaccggatgtc
ctctttggggccaagctgtactccacgtccatcgacatgtggtcagccggctgcatcttt
gcagagctggccaatgctgggcggcctctttttcccggcaatgatgtcgatgaccagttg
aagaggatcttccgactgctggggacgcccaccgaggagcagtggccctctatgaccaag
ctgccagactataagccctatccgatgtacccggccacaacatccctggtgaacgtcgtg
cccaaactcaatgccacagggagggacctgctgcagaaccttctgaagtgtaaccctgtc
cagcgtatctcagcagaagaggccctgcagcacccctacttctccgacttctgtccgccc
tag

DBGET integrated database retrieval system