KEGG   Pan troglodytes (chimpanzee): 463891Help
Entry
463891            CDS       T01005                                 

Gene name
CDK5
Definition
cyclin-dependent kinase 5
Orthology
K02090  
cyclin-dependent kinase 5 [EC:2.7.11.22]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Axon guidance
Alzheimer's disease
Cocaine addiction
Class
Organismal Systems; Development; Axon guidance [PATH:ptr04360]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:ptr05010]
Human Diseases; Substance dependence; Cocaine addiction [PATH:ptr05030]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 260 aa AA seqDB search
MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKH
KNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKNGELKLADFGLARAFG
IPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQL
KRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPV
QRISAEEALQHPYFSDFCPP
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaatacgagaaactggaaaagattggggaaggcacctacggaactgtgttcaag
gccaaaaaccgggagactcatgagatcgtggctctgaaacgggtgaggctggatgacgat
gatgagggtgtgccgagttcagccctccgggagatctgcctactcaaggagctgaagcac
aagaacatcgtcaggcttcatgatgtcctgcacagcgacaagaagctgactttggttttt
gaattctgtgaccaggacctgaagaagtattttgacagttgcaatggtgacctcgatcct
gagattgtaaagaatggggagctgaaattggctgattttggcctggctcgagcctttggg
attcccgtccgctgttactcagctgaggtggtcacactgtggtaccgcccaccggatgtc
ctctttggggccaagctgtactccacgtccatcgacatgtggtcagccggctgcatcttt
gcagagctggccaatgctgggcggcctctttttcccggcaatgatgtcgatgaccagttg
aagaggatcttccgactgctggggacgcccaccgaggagcagtggccctctatgaccaag
ctgccagactataagccctatccgatgtacccggccacaacatccctggtgaacgtcgtg
cccaaactcaatgccacagggagggacctgctgcagaaccttctgaagtgtaaccctgtc
cagcgtatctcagcagaagaggccctgcagcacccctacttctccgacttctgtccgccc
tag

DBGET integrated database retrieval system