KEGG   Pan troglodytes (chimpanzee): 463920Help
Entry
463920            CDS       T01005                                 

Gene name
MYL7
Definition
(RefSeq) myosin light chain 7
  KO
K12754  
myosin regulatory light chain 7
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Focal adhesion
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    463920 (MYL7)
  Cellular community - eukaryotes
   04510 Focal adhesion
    463920 (MYL7)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    463920 (MYL7)
Cytoskeleton proteins [BR:ptr04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     463920 (MYL7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 208 aa AA seqDB search
MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRET
YSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKG
VVNKDEFKQLLLTQADKFSPAEVRLPSPFNTHPQHLLWAFTHDPEPSTSEAVAGRVEQMF
ALTPMDLAGNIDYKSLCYIITHGDEKEE
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaggaaggcggggacccggggcaaggtggcagccaccaagcaggcccaacgt
ggttcttccaacgtcttttccatgtttgaacaagcccagatacaggagttcaaagaagcc
ttcagctgtattgaccagaatcgtgatggcatcatctgcaaggcagacctgagggagacc
tactcccagctggggaaggtgagtgtcccagaggaggagctggatgccatgctgcaggag
ggcaagggccccatcaacttcaccgtcttcctcacgctctttggggagaagctcaatggg
acagaccccgaggaagccatcctgagtgccttccgcatgtttgaccccagcggcaaaggg
gtggtgaacaaggatgagttcaagcagcttctcctgacccaggcagacaagttctctcca
gctgaggtgaggctgcccagccccttcaatactcatccccagcaccttctctgggccttc
acccatgacccagagcccagtaccagtgaggcagttgctggaagggtggagcagatgttc
gccctgacacccatggacctggcggggaacatcgactacaagtcactgtgctacatcatc
acccatggagacgagaaagaggaatga

DBGET integrated database retrieval system