KEGG   Pan troglodytes (chimpanzee): 463920Help
Entry
463920            CDS       T01005                                 

Gene name
MYL7
Definition
(RefSeq) myosin, light chain 7, regulatory
  KO
K12754  
myosin regulatory light chain 7
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    463920 (MYL7)
  Cellular commiunity
   04510 Focal adhesion
    463920 (MYL7)
   04530 Tight junction
    463920 (MYL7)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    463920 (MYL7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 208 aa AA seqDB search
MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRET
YSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKG
VVNKDEFKQLLLTQADKFSPAEVRLPSPFNTHPQHLLWAFTHDPEPSTSEAVAGRVEQMF
ALTPMDLAGNIDYKSLCYIITHGDEKEE
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaggaaggcggggacccggggcaaggtggcagccaccaagcaggcccaacgt
ggttcttccaacgtcttttccatgtttgaacaagcccagatacaggagttcaaagaagcc
ttcagctgtattgaccagaatcgtgatggcatcatctgcaaggcagacctgagggagacc
tactcccagctggggaaggtgagtgtcccagaggaggagctggatgccatgctgcaggag
ggcaagggccccatcaacttcaccgtcttcctcacgctctttggggagaagctcaatggg
acagaccccgaggaagccatcctgagtgccttccgcatgtttgaccccagcggcaaaggg
gtggtgaacaaggatgagttcaagcagcttctcctgacccaggcagacaagttctctcca
gctgaggtgaggctgcccagccccttcaatactcatccccagcaccttctctgggccttc
acccatgacccagagcccagtaccagtgaggcagttgctggaagggtggagcagatgttc
gccctgacacccatggacctggcggggaacatcgactacaagtcactgtgctacatcatc
acccatggagacgagaaagaggaatga

DBGET integrated database retrieval system