KEGG   Pan troglodytes (chimpanzee): 464048Help
Entry
464048            CDS       T01005                                 

Gene name
EGR3
Definition
early growth response 3
Orthology
K12497  
early growth response protein 3
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Hepatitis B
Viral carcinogenesis
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:ptr05203]
Human Diseases; Infectious diseases; Hepatitis B [PATH:ptr05161]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 387 aa AA seqDB search
MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSALNLFSGSSDSVVHYNQMATENVMDIGLT
NEKPNPELSYSGSFQPAPGNKTVTYLGKFAFDSPSNWCQDNIISLMSAGILGVPPASGAL
STQTSTASMVQPPQGDVEAMYPALPPYSNCGDLYSEPVSFHDPQGNPGLAYSPQDYQSAK
PALDSNLFPMIPDYNLYHHPNDMGSIPEHKPFQGMDPIRVNPPPITPLETIKAFKDKQIH
PGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAEGCDRRFSRSDELTRHLRIHT
GHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKE
KKAEKGGAPSASSAPPVSLAPVVTTCA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcaaactcgccgagaagctgccggtgaccatgagcagtttgctaaaccaactg
cctgacaatctgtaccccgaggagatccccagcgcgctcaacctcttctccggcagcagc
gactcggtagtccattacaatcagatggctacagagaatgtaatggacatcggtctgacc
aacgagaagcccaacccggaactctcttactccggctccttccagccagcccccggcaac
aagaccgtgacctacttgggaaagttcgccttcgactccccttccaactggtgccaggac
aacatcattagcctcatgagcgccggcatcttgggggtgcccccggcttcaggggcgctc
agcacgcagacgtccacggccagcatggtgcagccaccgcagggtgacgtggaggccatg
tatcccgcgctacccccctactccaactgcggcgacctctactcagagcccgtgtctttc
cacgacccccagggcaatcccgggctcgcctattccccccaggattaccaatcggccaag
ccggcgttggacagcaatctcttccccatgattcctgactacaacctctaccaccacccc
aacgacatgggctccattccggagcacaagcccttccagggcatggaccccatccgggtc
aacccgccccctattacccctctggagaccatcaaggcattcaaagacaagcagatccac
ccgggctttggcagcctgccccagccgccgctcaccctcaagcccatccggccccgcaag
taccccaaccggcctagcaagacaccgctccacgaacggccccacgcgtgcccggccgag
ggctgcgaccgccgtttcagccgttcggacgagctgacccggcacctgcgcatccacacg
ggccacaagcccttccagtgccggatctgcatgcggagcttcagccgcagcgaccacctc
accactcacatccgcactcatacgggcgagaagccctttgcctgcgagttctgcgggcgc
aagtttgcgcgcagcgacgagcgcaagcgccacgccaagatccacctcaagcaaaaggag
aagaaggcggagaagggcggtgcaccctctgcatcctcggcgccccccgtgtcgctggcc
cccgtggtcaccacctgcgcctga

DBGET integrated database retrieval system