KEGG   Pan troglodytes (chimpanzee): 464081Help
Entry
464081            CDS       T01005                                 

Gene name
ELP3
Definition
elongator acetyltransferase complex subunit 3
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
ptr  Pan troglodytes (chimpanzee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 547 aa AA seqDB search
MRQKRKGDLSPAELMMLTIGDVIKQLIEAHEQGKDIDLNKVKTKTAAKYGLSAQPRLVDI
IAAVPPQYRKVLIPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDF
EYSTQSYTGYEPTSMRAIRARYDPFLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEE
YRDYFIRNLHDALSGHTSNNIYEAVKYSERSLTKCIGITIETRPDYCMKRHLSDMLTYGC
TRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDSGFKVVAHMMPDLPNVGLERDIEQ
FTEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGRYKSYSPSDLVELVARILALVPPWT
RVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGIQCRDVRTREVGIQEIHHKVRPYQV
ELVRRDYVANGGWETFLSYEDPDQDILIGLLRLRKCSEETFRFELGGGVSIVRELHVYGS
VVPVSSRDPTKFQHQGFGMLLMEEAERIAREEHGSGKIAVISGVGTRNYYRKIGYRLQGP
YMVKMLK
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagaagcggaaaggagatctcagccctgctgagctgatgatgctgactatagga
gatgttattaaacaactgattgaagcccacgagcaggggaaagacatcgatctaaataag
gtgaaaaccaagacagctgccaaatatggcctttccgcccagccccgcctggtggatatc
attgctgccgttcctcctcagtatcgcaaggtcttgattcccaagttaaaggcgaaaccc
atcagaactgctagtgggattgctgtcgtggctgtgatgtgcaaaccccacagatgtcca
cacatcagttttacaggaaatatatgtgtatactgccctggtggacctgattctgatttt
gagtattccacccagtcttacactggctatgagccaacctctatgagagctatccgtgcc
agatatgaccctttcctacagacaagacaccgaatagaacagttaaaacaacttggtcat
agtgtggataaagtggagtttattgtgatgggtggaacgtttatggcccttccagaagaa
tacagagattattttattcgaaatttacatgatgccttatcaggacatacttccaacaat
atttacgaggcagtcaagtattctgagagaagcctcacaaagtgtattggaattactatt
gaaaccagaccagattactgcatgaagcgacatttaagtgacatgttgacctatggctgc
acaaggctggagattggggtgcagagtgtttatgaagatgtggctagagacaccaacagg
ggccacactgtgaaggcagtgtgtgagtcatttcacctggccaaagattccggttttaaa
gtggtggcccatatgatgcctgacctgccaaacgtgggactagaaagagacattgaacag
ttcacagagttttttgagaaccctgcttttcgtcccgatgggctgaaactctatcctacc
ctggtgattcgtgggactgggctttatgagctttggaaatcaggaagatataagagttac
tctcctagtgacctggtcgaattggtggctcggatcctagccctcgtgcctccatggact
cgagtgtaccgagtacagagggatattccaatgcctttagttagctcaggagtagagcat
ggtaacctgagagagctggcacttgcaagaatgaaagacctcggaatacagtgtcgagat
gtgagaaccagagaagttggaatccaagaaattcatcacaaagtacggccataccaggtt
gaattggtaaggagagattatgttgcaaatggtggctgggaaacattcttgtcatacgaa
gacccagatcaagacattttgattggcctcctacgattacgcaagtgttcagaagaaact
ttccgtttcgaattgggtggaggtgtctccatagtacgagagctgcatgtgtatgggagt
gtggtccctgtgagcagccgggatcctactaaatttcagcatcagggatttggcatgctg
ctgatggaggaagcagaaagaatagctagagaagaacatgggtctgggaaaatcgccgtg
atatcaggggtcggcaccaggaattattatagaaagatcggctacagattacaaggcccg
tacatggtgaagatgctgaaataa

DBGET integrated database retrieval system