KEGG   Pan troglodytes (chimpanzee): 464119Help
Entry
464119            CDS       T01005                                 

Gene name
WHSC1L1
Definition
Wolf-Hirschhorn syndrome candidate 1-like 1
Orthology
K11425  
histone-lysine N-methyltransferase NSD3 [EC:2.1.1.43]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    464119 (WHSC1L1)
Enzymes [BR:ptr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     464119 (WHSC1L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 1388 aa AA seqDB search
MDFSFSFMQGIMGNTIQQPPQLIDSANIRQEDAFDNNSDIAEDGGQTPYEATLQQGFQYP
ATTEDLPQLTNGYPSSISVYETQTKYQSYNQYPNGSANGFGAVRNFSPTDYYHSEIPNTR
PHEILEKPSPPQPPPPPSVPQTVIPKKTGSPEIKLKITKTIQNGRELFESSLCGDLLNEV
QASEHTKSKHESRKEKRKKSNKHDSSRSEERKSHKIPKLEPEEQNRPNERVDTVSEKPRE
EPVLKEEAPVQPILSSVPTTEVSTGVKFQVGDLVWSKVGTYPWWPCMVSSDPQLEVHTKI
NTRGAREYHVQFFSNQPERAWVHEKRVREYKGHKQYEELLAEATKQASNHSEKQKIRKPR
PQRERAQWDIGIAHAEKALKMTREERIEQYTFIYIDKQPEEALSQAKKNVASKTEVKKTR
RPRSVLNTQPEQTNAGEVASSLSSTEIRRHSQRRHTSAEEEEPPPVKIAWKTAAARKSLP
ASITMHKGSLDLQKCNMSPVVKIEQVFALQNATGDGKFIDQFVYSTKGIGNKTEISVRGQ
DRLIISTPNQRNEKPTQSVSSPEATSGSTGSVEKKQQRRSIRTRSESEKSTEVVPKKKIK
KEQVETVPQATVKTGLQKGASEISDSCKPLKKRSRASTDVEMTSSAYRDTSDSDSRGLSD
LQVGFGKQVDSPSATADADVSDVQSMDSSLSRRGTGMSKKDTVCQICESSGDSLIACEGE
CCKHFHLECLGLTSLPDSKFICMECKTGQHPCFSCKVSGKDVKRCSVGACGKFYHEACVR
KFPTAIFESKGFRCPQHCCSACSMEKDIHKASKGRMMRCLRCPVAYHSGDACIAAGSMLV
SSYILICSNHSKRSSNSSAVNVGFCFVCARGGRLLCCESCPASFHPECLSIEMPEGCWNC
NDCKAGKKLHYKQIVWVKLGNYRWWPAEICNPRSVPLNIQGLKHDLGDFPVFFFGSHDYY
WVHQGRVFPYVEGDKSFAEGQTSINKTFKKALEEAAKRFQELKAQRESKEALEIEKNSRK
PPPYKHIKANKVIGKVQIQVADLSEIPRCNCKPADENPCGLESECLNRMLQYECHPQVCP
AGDRCQNQCFTKRLYPDAEIIKTERRGWGLRTKRSIKKGEFVNEYVGELIDEEECRLRIK
RAHENSVTNFYMLTVTKDRIIDAGPKGNYSRFMNHSCNPNCETQKWTVNGDVRVGLFALC
DIPAGMELTFNYNLDCLGNGRTECHCGADNCSGFLGVRPKSACASTNEEKAKNAKLKQKR
RKIKTEPKQMHEDYCFQCGDGGELVMCDKKDCPKAYHLLCLNLTQPPYGKWECPWHQCDE
CSSAAVSFCEFCPHSFCKDHEKGALVPSALEGRLCCLEHDPMAPVSPEYWSKIKCKWESQ
DHGEEVKE
NT seq 4167 nt NT seq  +upstreamnt  +downstreamnt
atggatttctctttctctttcatgcaagggatcatgggaaacacaattcagcaaccacct
caactcattgactccgccaacatccgtcaggaggatgcctttgataacaacagtgacatt
gctgaagatggtggccagacaccatatgaagctactttgcagcaaggctttcagtaccca
gctacaacagaagatcttcctcaactcacaaatgggtatccatcatcaatcagtgtgtat
gaaactcaaaccaaataccagtcatataatcagtatcctaatgggtcagccaatggcttt
ggtgcagttagaaactttagccccactgactattatcattcagaaattccaaacacaaga
ccacatgaaattctggaaaaaccttcccctccacagccaccacctcctccttcggtacca
caaactgtgattccaaagaagactggctcacctgaaattaaactaaaaataaccaaaact
atccagaatggcagggaattgtttgagtcttccctttgtggagaccttttaaatgaagta
caggcaagtgagcacacgaaatcaaagcatgaaagcagaaaagaaaagaggaaaaaaagc
aacaagcatgactcatcaagatctgaagagcgcaagtcacacaaaatccccaaattagaa
ccagaggaacaaaatagaccaaatgagagggttgacactgtatcagaaaaaccaagggaa
gaaccagtactaaaagaggaagccccagttcagccaatactatcttctgttccaacaacg
gaagtgtccactggtgttaagtttcaggttggcgatcttgtgtggtccaaggtgggaacc
tatccttggtggccttgtatggtttcaagtgatccccagcttgaggttcatactaaaatt
aacacaagaggtgcccgagaatatcatgtccagttttttagcaaccagccagagagggcg
tgggttcatgaaaaacgggtacgagagtataaaggtcataaacagtatgaagaattactg
gctgaggcaaccaaacaagccagcaatcactctgagaaacaaaagattcggaaaccccga
cctcagagagaacgtgctcagtgggatattggcattgcccatgcagagaaagcattgaaa
atgactcgagaagaaagaatagaacagtatacttttatttacattgataaacagcctgaa
gaggctttatcccaagcaaaaaagaatgttgcctccaaaaccgaagttaaaaaaacccga
cgaccaagatctgtgctgaatactcagccagaacagaccaatgcaggggaggtggcctcc
tcactctcaagtactgaaattcggagacatagccagaggcggcacacaagtgcggaagag
gaagagccaccgcctgttaaaatagcctggaaaactgcggcagcaaggaaatccttacca
gcttccattacgatgcacaaagggagcctggatttgcagaagtgtaacatgtctccagtt
gtgaaaattgaacaagtgtttgctcttcagaatgctacaggggatgggaaatttatcgat
caatttgtttattcaacaaagggaattggtaacaaaacagaaataagtgtcagggggcaa
gacaggcttataatttctacaccaaaccagagaaatgaaaagccaacgcagagtgtatca
tctcctgaagcaacatctggttctacaggctcagtagaaaagaagcaacagagaagatca
attagaactcgttctgaatcagagaaatccactgaggttgtgccaaagaagaagatcaaa
aaggagcaggttgaaacagttcctcaggctacagtgaagactggattacagaaaggtgcc
agcgagatttcagattcctgtaaacctctaaagaaaaggagtcgcgcctcaactgatgta
gaaatgactagttcagcatacagagacacatctgactccgattctagaggactgagtgac
ctgcaggtaggctttggaaagcaagtagatagcccttcagctactgcagatgcagacgtt
tctgatgtgcagtccatggattcaagtttgtcgagaagaggcactggaatgagtaagaag
gacactgtatgtcagatttgtgaaagctctggtgactctctgattgcttgtgagggagag
tgctgcaaacactttcacctggagtgcctgggattgacatcacttcctgatagcaagttc
atctgcatggaatgtaaaactgggcagcacccatgtttttcgtgtaaagtgtctggtaaa
gatgtgaagcgttgttctgttggtgcttgtgggaaattttatcatgaagcctgtgtccgc
aaattccccactgccatctttgaatcaaaaggattccgctgtcctcagcactgctgctct
gcctgctctatggagaaagatatccacaaagcaagtaaaggccgcatgatgagatgttta
agatgtccagttgcctatcactctggagatgcttgcattgcggctggaagcatgttagta
tcctcctacattctcatctgtagtaatcattccaaacggagcagtaattcttctgctgta
aatgtaggcttttgtttcgtttgtgccagaggtggaagattgctctgctgtgaatcgtgc
ccagcttccttccacccggaatgcctaagcatagaaatgccagaaggctgctggaattgt
aatgactgtaaagctggcaagaaactacattacaagcagattgtttgggtcaaattggga
aattacagatggtggccagcagagatctgcaaccccaggtctgtgccactgaacatccag
ggccttaaacatgacttgggggacttccctgtattcttctttggttctcatgactactac
tgggtacaccagggcagagtgttcccttatgttgaaggagacaaaagctttgctgagggg
cagactagtattaacaagaccttcaaaaaggcactggaagaagctgcaaaacgtttccag
gaattgaaagcacaaagagaaagtaaagaagccctagagattgaaaaaaactcaagaaaa
ccccctccctacaaacacatcaaagctaacaaagtaataggaaaggtgcagatccaggtt
gctgacctgtcagagattccccgctgtaactgcaagccagctgatgaaaacccttgtggc
ttggaatcggagtgcctgaacagaatgttgcagtatgaatgccacccgcaggtgtgccca
gctggagatcgttgtcagaaccagtgctttacaaagagactataccctgatgcagagatc
atcaaaacggagcggagaggctggggcctcaggaccaaaaggagcattaagaagggtgaa
tttgtaaatgaatacgtcggtgaattaattgatgaagaagaatgcagattgcgaatcaag
cgagcccacgagaacagtgtaactaatttttatatgttaactgttaccaaggaccgtata
attgatgctggcccaaaaggaaattattctcgcttcatgaaccacagttgtaatcccaac
tgtgaaacacaaaagtggacagtgaatggagatgttcgagtgggactatttgctctctgt
gatattcctgcagggatggagttaacatttaattataacctagattgtctgggcaacggc
agaacggagtgccactgtggggcagataactgcagtggttttctaggagtgcggccaaag
tcggcatgtgcgtcaacaaatgaagagaaggcaaaaaatgctaagttaaaacagaagaga
cgaaagatcaaaacagaaccaaagcagatgcatgaagattactgttttcaatgtggagat
ggtggagagctggtcatgtgtgacaaaaaagactgtcccaaagcataccacctcctatgc
cttaacctgactcagccaccatatggaaagtgggagtgtccgtggcatcagtgcgatgag
tgcagcagtgcagctgtttccttctgtgaattctgtccacattcattttgtaaagatcat
gaaaagggggccctggttccctctgcactggaaggccgcctctgctgcttggaacatgac
cccatggctcctgtgtcaccagaatactggagcaagataaaatgtaaatgggaatcacaa
gatcatggagaagaagtaaaagaataa

DBGET integrated database retrieval system